SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF365402-2|AAK53386.1| 1059|Drosophila melanogaster reverse tran...    72   8e-13
AF315785-1|AAK01366.1|  437|Drosophila melanogaster pol polyprot...    72   8e-13
AF541949-2|AAN34652.1|  826|Drosophila melanogaster pol protein ...    71   1e-12
AF420242-1|AAL16060.1|  826|Drosophila melanogaster RNA-directed...    71   1e-12
AF492764-2|AAM11674.1|  849|Drosophila melanogaster pol protein ...    70   3e-12
X04132-4|CAA27750.1| 1237|Drosophila melanogaster protein ( Dros...    68   1e-11
AY928609-2|AAX28841.1| 1000|Drosophila melanogaster RNA-dependen...    68   1e-11
AJ000387-3|CAA04050.1| 1217|Drosophila melanogaster reverse tran...    67   2e-11
X01472-2|CAA25702.1| 1058|Drosophila melanogaster protein ( Dros...    66   6e-11
AJ009736-2|CAA08807.1| 1150|Drosophila melanogaster Pol protein ...    66   6e-11
AY180918-2|AAN87271.1| 1003|Drosophila melanogaster ORF2 protein.      65   7e-11
AF541948-2|AAN34651.1| 1006|Drosophila melanogaster pol protein ...    65   1e-10
AY928610-2|AAX28844.1| 1088|Drosophila melanogaster reverse tran...    64   1e-10
AY180916-3|AAN87268.1|  994|Drosophila melanogaster ORF3 protein.      64   2e-10
AF364550-2|AAK52058.1| 1065|Drosophila melanogaster RNA-directed...    64   2e-10
X14037-1|CAA32198.1| 1053|Drosophila melanogaster polyprotein pr...    64   2e-10
AY113457-1|AAM29462.1|  825|Drosophila melanogaster RE36839p pro...    64   2e-10
X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein.         63   4e-10
X03431-2|CAB57796.1| 1059|Drosophila melanogaster protein ( Dros...    62   5e-10
AF364549-2|AAK52055.1| 1013|Drosophila melanogaster RNA-directed...    60   4e-09
AF222049-2|AAF36671.1| 1037|Drosophila melanogaster pol protein ...    59   5e-09
X03734-1|CAA27371.1|  930|Drosophila melanogaster protein ( D. m...    58   8e-09
M12927-2|AAA70219.1| 1010|Drosophila melanogaster unknown protei...    58   8e-09
EF591042-2|ABQ84943.1| 1045|Drosophila melanogaster pol protein ...    58   8e-09
DQ887187-2|ABI48306.1| 1010|Drosophila melanogaster pol protein ...    58   8e-09
DQ887186-2|ABI48303.1| 1010|Drosophila melanogaster pol protein ...    58   8e-09
AF033821-2|AAC82604.1| 1463|Drosophila melanogaster Prgag-pol pr...    58   8e-09
EF591043-2|ABQ84946.1| 1045|Drosophila melanogaster pol protein ...    57   2e-08
AF541947-2|AAN34648.1|  407|Drosophila melanogaster truncated po...    54   2e-07
Z27119-1|CAA81643.1| 1333|Drosophila melanogaster blastopia poly...    52   5e-07
AY050234-1|AAK84933.1| 1026|Drosophila melanogaster SD02026p pro...    52   5e-07
U89994-2|AAB50148.1| 1041|Drosophila melanogaster reverse transc...    50   4e-06
X52759-1|CAA36970.1|  365|Drosophila melanogaster glutamine synt...    29   7.7  

>AF365402-2|AAK53386.1| 1059|Drosophila melanogaster reverse
           transcriptase-like polymeraseprotein.
          Length = 1059

 Score = 71.7 bits (168), Expect = 8e-13
 Identities = 37/106 (34%), Positives = 61/106 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ ++   +     KC F   +V FLG  +S  G +    ++QA+ DFP+P+T++ LR F
Sbjct: 374 FRTLQQANMKCQLDKCEFMKRKVEFLGFVVSDKGIETSPTKVQAISDFPIPRTLKELRSF 433

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNAL 561
           +G+  YYRRF+ N AKL  PL + +   + ++S      LSSK ++
Sbjct: 434 LGLSGYYRRFIPNYAKLAKPLSSLLRGEDGRISRT----LSSKKSV 475



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   + QI +   DI KTA     G YEF  + FGL+NA   FQR +D+
Sbjct: 289 LDLKSGFHQILLKESDIEKTAFSINNGKYEFTRLPFGLKNAPSIFQRALDD 339



 Score = 36.7 bits (81), Expect = 0.029
 Identities = 13/30 (43%), Positives = 22/30 (73%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           CF Y+DDI+++S+D   H  +L T+F+ L+
Sbjct: 349 CFIYIDDIIIFSKDDETHYQNLDTIFRTLQ 378


>AF315785-1|AAK01366.1|  437|Drosophila melanogaster pol polyprotein
           protein.
          Length = 437

 Score = 71.7 bits (168), Expect = 8e-13
 Identities = 37/106 (34%), Positives = 61/106 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ ++   +     KC F   +V FLG  +S  G +    ++QA+ DFP+P+T++ LR F
Sbjct: 218 FRTLQQANMKCQLDKCEFMKRKVEFLGFVVSDKGIETSPTKVQAISDFPIPRTLKELRSF 277

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNAL 561
           +G+  YYRRF+ N AKL  PL + +   + ++S      LSSK ++
Sbjct: 278 LGLSGYYRRFIPNYAKLAKPLSSLLRGEDGRISRT----LSSKKSV 319



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 22/50 (44%), Positives = 28/50 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL   + QI +   DI KTA     G YEF  + FGL+NA   FQR +D
Sbjct: 132 LDLKSGFHQILLKESDIEKTAFSINNGKYEFTRLPFGLKNAPSIFQRALD 181


>AF541949-2|AAN34652.1|  826|Drosophila melanogaster pol protein
           protein.
          Length = 826

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 29/75 (38%), Positives = 43/75 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F     Y + ++P KC F   EVTFLG++ +  G  P  ++   +K++P+P      RRF
Sbjct: 83  FNVCRKYNLKLHPEKCSFFMHEVTFLGHKCTDKGVLPDDKKYDVIKNYPVPHDADSARRF 142

Query: 424 IGMVNYYRRFLRNAA 468
           +   NYYRRF+RN A
Sbjct: 143 VAFCNYYRRFIRNFA 157


>AF420242-1|AAL16060.1|  826|Drosophila melanogaster RNA-directed
           DNA polymerase protein.
          Length = 826

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 29/75 (38%), Positives = 43/75 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F     Y + ++P KC F   EVTFLG++ +  G  P  ++   +K++P+P      RRF
Sbjct: 83  FNVCRKYNLKLHPEKCSFFMHEVTFLGHKCTDKGVLPDDKKYDVIKNYPVPHDADSARRF 142

Query: 424 IGMVNYYRRFLRNAA 468
           +   NYYRRF+RN A
Sbjct: 143 VAFCNYYRRFIRNFA 157


>AF492764-2|AAM11674.1|  849|Drosophila melanogaster pol protein
           protein.
          Length = 849

 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 29/85 (34%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +    + +   KC F   E TFLG+ I+ DG +P  E+I+A++D+PLP   + ++ F
Sbjct: 348 FEKLSQANLKLQLDKCEFLRQETTFLGHVITKDGIKPNPEKIKAIQDYPLPSKPKEIKAF 407

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  YYR+F+ N + +  PL   +
Sbjct: 408 LGITGYYRKFIPNFSDIAKPLTKCL 432



 Score = 55.2 bits (127), Expect = 8e-08
 Identities = 26/48 (54%), Positives = 31/48 (64%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           TIDL K + QI +  E I KTA  T +G YE+  M FGL+NA  TFQR
Sbjct: 262 TIDLAKGFHQIEMDSESIAKTAFSTKYGHYEYTRMPFGLKNAPATFQR 309



 Score = 32.3 bits (70), Expect = 0.63
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           C  Y+DDI+V+S    +H   L  +F++L    +L +Q + C
Sbjct: 323 CLVYLDDIIVFSTSLEEHLQSLEAVFEKLS-QANLKLQLDKC 363


>X04132-4|CAA27750.1| 1237|Drosophila melanogaster protein (
           Drosophila retrotransposon412 genome. ).
          Length = 1237

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F    +Y + ++P KC F   EVTFLG++ +  G  P  ++   ++++P+P      RRF
Sbjct: 494 FGKCREYNLKLHPEKCSFFMHEVTFLGHKCTDKGILPDDKKYDVIQNYPVPHDADSARRF 553

Query: 424 IGMVNYYRRFLRNAA 468
           +   NYYRRF++N A
Sbjct: 554 VAFCNYYRRFIKNFA 568



 Score = 31.5 bits (68), Expect = 1.1
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           P  WT E ++ F   K  L +  L+ +P  + E  + TDAS    GA
Sbjct: 583 PFEWTDECQKAFIHLKSQLINPTLLQYPDFSKEFCITTDASKQACGA 629



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL+  + QI +       T+  T  G Y F  + FGL+ A  +FQR +
Sbjct: 409 LDLMSGFHQIELDEGSRDITSFSTSNGSYRFTRLPFGLKIAPNSFQRMM 457


>AY928609-2|AAX28841.1| 1000|Drosophila melanogaster RNA-dependent
           DNA polymerase protein.
          Length = 1000

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F    +Y + ++P KC F   EVTFLG++ +  G  P  ++   ++++P+P      RRF
Sbjct: 257 FGKCREYNLKLHPEKCSFFMHEVTFLGHKCTDKGILPDDKKYDVIQNYPVPHDADSARRF 316

Query: 424 IGMVNYYRRFLRNAA 468
           +   NYYRRF++N A
Sbjct: 317 VAFCNYYRRFIKNFA 331



 Score = 31.5 bits (68), Expect = 1.1
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           P  WT E ++ F   K  L +  L+ +P  + E  + TDAS    GA
Sbjct: 346 PFEWTDECQKAFIHLKSQLINPTLLQYPDFSKEFCITTDASKQACGA 392



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL+  + QI +       T+  T  G Y F  + FGL+ A  +FQR +
Sbjct: 172 LDLMSGFHQIELDEGSRDITSFSTSNGSYRFTRLPFGLKIAPNSFQRMM 220


>AJ000387-3|CAA04050.1| 1217|Drosophila melanogaster reverse
           transcriptase protein.
          Length = 1217

 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 26/85 (30%), Positives = 50/85 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +      + P+K  F   E+ FLG+ ++ DG +P   +I A+K FP P   + ++ F
Sbjct: 495 FEKLRAANFKLQPSKSEFLRKEIEFLGHIVTQDGVKPNPNKISAIKKFPCPTNRRAIKSF 554

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G++ YYR+F+R+ A++  P+   +
Sbjct: 555 LGLLGYYRKFIRDFARITKPMTKQL 579



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 26/51 (50%), Positives = 32/51 (62%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+DL   + QI + P+DI KTA     G YEF  M FGL+NA  TFQR +D
Sbjct: 409 TLDLTSGFHQIEMNPKDIAKTAFTVEGGHYEFTRMPFGLKNAPATFQRVMD 459



 Score = 31.5 bits (68), Expect = 1.1
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           KG   +T   +  + F  CK  LS+  ++ HP       L TDAS+  +GA  ++
Sbjct: 580 KGKRQVTTDKDFVDAFEQCKTLLSNDPILIHPDFEKPFILTTDASNFALGAVLSQ 634



 Score = 29.5 bits (63), Expect = 4.4
 Identities = 9/30 (30%), Positives = 20/30 (66%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           C  Y+DDI+++S    +H   ++ +F++L+
Sbjct: 470 CLFYLDDIIIFSPSLQKHLLDIKMVFEKLR 499


>X01472-2|CAA25702.1| 1058|Drosophila melanogaster protein (
           Drosophila melanogastercopia-like element 17.6. ).
          Length = 1058

 Score = 65.7 bits (153), Expect = 6e-11
 Identities = 26/85 (30%), Positives = 50/85 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +    + +   KC F   E TFLG+ ++ DG +P  E+I+A++ +P+P   + ++ F
Sbjct: 386 FEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAF 445

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  YYR+F+ N A +  P+   +
Sbjct: 446 LGLTGYYRKFIPNFADIAKPMTKCL 470



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 26/52 (50%), Positives = 34/52 (65%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           TIDL K + QI + PE + KTA  T  G YE+  M FGL+NA  TFQR +++
Sbjct: 300 TIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMND 351



 Score = 30.3 bits (65), Expect = 2.5
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           C  Y+DDI+V+S    +H   L  +F++L    +L +Q + C
Sbjct: 361 CLVYLDDIIVFSTSLDEHLQSLGLVFEKL-AKANLKLQLDKC 401


>AJ009736-2|CAA08807.1| 1150|Drosophila melanogaster Pol protein
           protein.
          Length = 1150

 Score = 65.7 bits (153), Expect = 6e-11
 Identities = 26/81 (32%), Positives = 50/81 (61%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ + D  + +   KC F   E  FLG+ ++ +G +P   + +A+ +FPLP+T + ++ F
Sbjct: 459 FEKLRDANLKLQLDKCEFMKKETEFLGHIVTTNGIKPNPNKTKAITNFPLPKTPKQIKSF 518

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+  +YR+F+ N AK+  P+
Sbjct: 519 LGLCGFYRKFIPNFAKIVKPM 539



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 25/48 (52%), Positives = 29/48 (60%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           TIDL K + QI +    I KTA  T  G YE+  M FGL+NA  TFQR
Sbjct: 373 TIDLAKGFHQIQMDENSIAKTAFSTKHGHYEYTRMPFGLKNAPATFQR 420



 Score = 35.9 bits (79), Expect = 0.051
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = +2

Query: 161 YDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y  C  Y+DDI+VYS    +H   L+ +F++L+   +L +Q + C
Sbjct: 431 YKDCLVYLDDIIVYSTPLEEHILSLKKVFEKLR-DANLKLQLDKC 474


>AY180918-2|AAN87271.1| 1003|Drosophila melanogaster ORF2 protein.
          Length = 1003

 Score = 65.3 bits (152), Expect = 7e-11
 Identities = 28/73 (38%), Positives = 49/73 (67%)
 Frame = +1

Query: 274 INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRF 453
           +N  K  F   +V FLG  ++ADG +   ++++A+ + P P +V+ L+RF+GM +YYR+F
Sbjct: 312 VNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMTSYYRKF 371

Query: 454 LRNAAKLQAPLVN 492
           +++ AK+  PL N
Sbjct: 372 IQDYAKVAKPLTN 384



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 25/52 (48%), Positives = 31/52 (59%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   + QI +   DI KTA  T  G YEF  + FGL+NA   FQR ID+
Sbjct: 216 TLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDD 267



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           C+ Y+DDI+V+S D   H  +LR +   L
Sbjct: 277 CYVYIDDIIVFSEDYDTHWKNLRLVLASL 305



 Score = 29.1 bits (62), Expect = 5.8
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           PIT      + FN  K  L S+ ++A P       L TDAS+  +GA  ++
Sbjct: 402 PITLDETALQSFNDLKSILCSSEILAFPCFTKPFHLTTDASNWAIGAVLSQ 452


>AF541948-2|AAN34651.1| 1006|Drosophila melanogaster pol protein
           protein.
          Length = 1006

 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 25/85 (29%), Positives = 53/85 (62%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQA+ +  + +   KC F   +  FLG+ +S +G +P  E+++A++++PLP   + ++ F
Sbjct: 333 FQALSNANLKLQLDKCEFLKHDTYFLGHMVSPEGIRPNPEKLRAIENYPLPTKPKEIKSF 392

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  +YR+F+ + A++  PL   +
Sbjct: 393 LGLTGFYRKFIPHFAQIAKPLTTCL 417



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 27/52 (51%), Positives = 35/52 (67%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           TIDL+K + QI + PE I KTA  T  G YE+  M FGL+NA  TFQR +++
Sbjct: 247 TIDLIKGFHQIEMDPESIPKTAFTTKTGHYEYTRMPFGLKNAPATFQRCMND 298



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           C  Y+DDI+V+S    +H   LR +F+ L    +L +Q + C
Sbjct: 308 CMVYLDDIIVFSASLEEHLQSLRAVFQALS-NANLKLQLDKC 348


>AY928610-2|AAX28844.1| 1088|Drosophila melanogaster reverse
           transcriptase protein.
          Length = 1088

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 26/85 (30%), Positives = 49/85 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +      +   K  F   E  FLG+ +S +G +P   +I+A+K+FP P + + ++ F
Sbjct: 381 FGRLRSANFKVQLTKSYFLRRETEFLGHIVSQEGVRPNPNKIEAIKNFPCPHSKKSIKSF 440

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G++ YYR+F+R+ A+L  P+   +
Sbjct: 441 LGLLGYYRKFIRDFARLTQPMTQKL 465



 Score = 52.0 bits (119), Expect = 7e-07
 Identities = 25/51 (49%), Positives = 31/51 (60%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+DL   + QI + P+D  KTA     G YEF  M FGL+NA  TFQR +D
Sbjct: 295 TLDLASGFHQIEMNPDDTPKTAFTVEGGHYEFIRMPFGLKNAPATFQRVMD 345



 Score = 37.9 bits (84), Expect = 0.013
 Identities = 13/30 (43%), Positives = 21/30 (70%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           C  Y+DDI+++S    +H  HL+T+F RL+
Sbjct: 356 CLVYLDDIIIFSTSLQEHFIHLKTIFGRLR 385


>AY180916-3|AAN87268.1|  994|Drosophila melanogaster ORF3 protein.
          Length = 994

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+    + + ++P KC F   EVT+LG++ +  G  P   + + ++ +P+P      RRF
Sbjct: 249 FELCRRHNLKLHPGKCSFFMKEVTYLGHKCTDKGILPDDTKYEVIEKYPIPTDADSARRF 308

Query: 424 IGMVNYYRRFLRN 462
           +   NYYRRF++N
Sbjct: 309 VAFCNYYRRFIKN 321



 Score = 29.5 bits (63), Expect = 4.4
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +DL+  + QI +       T+  T  G Y F  + +GL+ A  +FQR
Sbjct: 164 LDLMSGFHQIELEKRYRDITSFSTANGSYRFTRLPYGLKVAPNSFQR 210



 Score = 29.1 bits (62), Expect = 5.8
 Identities = 15/44 (34%), Positives = 19/44 (43%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           WT E  + F   K  L    L+ +P    E  + TDAS    GA
Sbjct: 341 WTAECNDAFEYLKTELMKPTLLQYPDFGKEFCITTDASKQACGA 384


>AF364550-2|AAK52058.1| 1065|Drosophila melanogaster RNA-directed
           DNA polymerase protein.
          Length = 1065

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 26/81 (32%), Positives = 50/81 (61%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  + +  + +   KC F   E  FLG+ I+ DG +P   +I+A+ +FP+P++ + ++ F
Sbjct: 374 FLKLREANLKLQLDKCEFLKKETEFLGHIITTDGIKPNPAKIKAVVNFPIPKSTKEIKSF 433

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+  +YR+F+ N AK+  P+
Sbjct: 434 LGLCGFYRKFIPNFAKIAKPM 454



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 24/48 (50%), Positives = 29/48 (60%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           TIDL K + QI +    I KTA  T  G +E+  M FGL+NA  TFQR
Sbjct: 288 TIDLAKGFHQIQMDENSIAKTAFSTKNGHFEYTRMPFGLKNAPATFQR 335



 Score = 37.1 bits (82), Expect = 0.022
 Identities = 21/58 (36%), Positives = 31/58 (53%)
 Frame = +2

Query: 161 YDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLRLLFSETEY 334
           Y  C  Y+DDI+VYS    +H   LR +F +L+   +L +Q + C      L  ETE+
Sbjct: 346 YKNCLVYLDDIIVYSTSLEEHIMSLRKVFLKLR-EANLKLQLDKC----EFLKKETEF 398


>X14037-1|CAA32198.1| 1053|Drosophila melanogaster polyprotein
           protein.
          Length = 1053

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 29/74 (39%), Positives = 43/74 (58%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G   N AKC F    V +LG  + A   +P   +I +L   P PQTV G+R+FIG+ +Y+
Sbjct: 627 GFTFNLAKCSFLKTTVQYLGYEVRAGEIRPNVRKIASLSSLPPPQTVSGVRQFIGLASYF 686

Query: 445 RRFLRNAAKLQAPL 486
           R+F+   ++L  PL
Sbjct: 687 RKFVSGFSQLMKPL 700


>AY113457-1|AAM29462.1|  825|Drosophila melanogaster RE36839p
           protein.
          Length = 825

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 27/75 (36%), Positives = 42/75 (56%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+      + ++P KC F   EVTFLG++ +  G  P   +  A++ +P+P      RRF
Sbjct: 388 FELCRKNNLKLHPDKCSFFMSEVTFLGHKCTDKGILPDDTKYDAIQRYPVPTDADSARRF 447

Query: 424 IGMVNYYRRFLRNAA 468
           +   NYYRRF++N A
Sbjct: 448 VAFCNYYRRFIQNFA 462



 Score = 32.7 bits (71), Expect = 0.47
 Identities = 16/52 (30%), Positives = 27/52 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +DL+  + QI +  +    T+  T  G Y F  + +GL+ A  +FQR +  A
Sbjct: 303 LDLMSGFHQIELEEDSRNITSFSTSSGSYRFTRLPYGLKIAPNSFQRMMTMA 354



 Score = 29.5 bits (63), Expect = 4.4
 Identities = 14/44 (31%), Positives = 21/44 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           WT + +  F   K  L +  L+ +P  + E  + TDAS    GA
Sbjct: 480 WTADCQHAFEHLKKQLMNPTLLKYPDFSKEFCIITDASKEACGA 523


>X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein.
          Length = 1494

 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 26/81 (32%), Positives = 50/81 (61%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ + +  + +   KC F    + +LG  I+ DG  P  + I+A+K+FP+P  V  ++ F
Sbjct: 891  FKRLVENKLELRIDKCEFMQSSIKYLGFIINKDGIMPNDKGIEAIKNFPIPNNVHTVQSF 950

Query: 424  IGMVNYYRRFLRNAAKLQAPL 486
            +G+ +Y+RRF+++ ++L  PL
Sbjct: 951  LGLCSYFRRFIKDFSRLAKPL 971



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 24/56 (42%), Positives = 34/56 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFA 173
           +DL   +  + V  E I  T+ +TP G YE+  M FGL+NA   FQRF+++  IFA
Sbjct: 805 LDLKNGFFHVHVKKESIKYTSFVTPLGQYEWLRMPFGLKNAPSVFQRFVNK--IFA 858


>X03431-2|CAB57796.1| 1059|Drosophila melanogaster protein (
           Drosophila melanogastertransposable element 297. ).
          Length = 1059

 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 27/102 (26%), Positives = 55/102 (53%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  + D  + +   KC F   E  FLG+ ++ DG +P   +++A+  +P+P   + +R F
Sbjct: 385 FTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAF 444

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSS 549
           +G+  YYR+F+ N A +  P+ + +     K+  + L ++ +
Sbjct: 445 LGLTGYYRKFIPNYADIAKPMTSCL-KKRTKIDTQKLEYIEA 485



 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 27/48 (56%), Positives = 30/48 (62%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           TIDL K + QI +  E I KTA  T  G YE+  M FGLRNA  TFQR
Sbjct: 299 TIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQR 346



 Score = 30.3 bits (65), Expect = 2.5
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           C  Y+DDI+++S    +H   ++ +F +L    +L +Q + C
Sbjct: 360 CLVYLDDIIIFSTSLTEHLNSIQLVFTKL-ADANLKLQLDKC 400


>AF364549-2|AAK52055.1| 1013|Drosophila melanogaster RNA-directed
           DNA polymerase protein.
          Length = 1013

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 30/96 (31%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           +++ D  + I+  K  F    V+FLG  ++ +G     E+++A+K+FP P+ V  +R F+
Sbjct: 339 KSLYDANMRISAEKSRFFKKSVSFLGFIVTNNGAATDPEKVKAIKEFPEPKNVFEVRSFL 398

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEVKVS-HRS 531
           G+ +YYR F+++ A +  P+ + +      VS HRS
Sbjct: 399 GLASYYRCFIKDFASIARPISDILKGENGSVSRHRS 434



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 26/52 (50%), Positives = 30/52 (57%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   Y QI +A  D  KTA     G YEF  + FGLRNA   FQR ID+
Sbjct: 252 TLDLKSGYHQITLAERDREKTAFAVNGGKYEFRRLPFGLRNAASIFQRTIDD 303



 Score = 35.9 bits (79), Expect = 0.051
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           FC+ YVDD++++S D   H  H+  + K L
Sbjct: 312 FCYVYVDDVIIFSEDENDHVKHVDWVLKSL 341


>AF222049-2|AAF36671.1| 1037|Drosophila melanogaster pol protein
           protein.
          Length = 1037

 Score = 59.3 bits (137), Expect = 5e-09
 Identities = 23/82 (28%), Positives = 47/82 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +    + +   KC F   E+ FLG+ I+++G +P  ++I A+    LP   + ++ F
Sbjct: 311 FSCLSKANLKLQSDKCEFAREEIEFLGHTINSEGLKPSQKKIDAICKINLPTNQKQIKSF 370

Query: 424 IGMVNYYRRFLRNAAKLQAPLV 489
           +G+  Y RR++++ +K+  PL+
Sbjct: 371 LGITGYLRRYIKDYSKIAQPLI 392



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 26/51 (50%), Positives = 33/51 (64%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+DL K + QI +  +D+ KTA  T  G YEF  M FGLRNA  TFQR ++
Sbjct: 225 TLDLAKGFYQIEMDNKDVHKTAFSTTSGHYEFLRMPFGLRNAPSTFQRLMN 275



 Score = 37.9 bits (84), Expect = 0.013
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           FC  Y+DDIL++S++  +H  HL  +F  L    +L +Q + C
Sbjct: 285 FCIVYMDDILIFSKNIGEHVNHLSCIFSCLS-KANLKLQSDKC 326


>X03734-1|CAA27371.1|  930|Drosophila melanogaster protein ( D.
           melanogaster retrotransposongypsy gene fragment for
           reverse transcriptase-like enzyme.).
          Length = 930

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 29/98 (29%), Positives = 54/98 (55%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  + ++  K  F    V +LG  +S DGT+   E+++A++++P P  V  +R F+G+ +
Sbjct: 346 DANMRVSQEKTRFFKESVEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLAS 405

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSK 552
           YYR F+++ A +  P+ + +      VS     H+S K
Sbjct: 406 YYRVFIKDFAAIARPITDILKGENGSVSK----HMSKK 439



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   Y QI +A  D  KT+     G YEF  + FGLRNA   FQR +D+
Sbjct: 255 TLDLKSGYHQIYLAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDD 306



 Score = 35.1 bits (77), Expect = 0.089
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 9/50 (18%)
 Frame = +2

Query: 134 NVSKIYRRSYD---------FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           N S I++R+ D          C+ YVDD++++S +   H  H+ T+ K L
Sbjct: 295 NASSIFQRALDDVLREQIGKICYVYVDDVIIFSENESDHVRHIDTVLKCL 344


>M12927-2|AAA70219.1| 1010|Drosophila melanogaster unknown protein
           protein.
          Length = 1010

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 29/98 (29%), Positives = 54/98 (55%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  + ++  K  F    V +LG  +S DGT+   E+++A++++P P  V  +R F+G+ +
Sbjct: 341 DANMRVSQEKTRFFKESVEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLAS 400

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSK 552
           YYR F+++ A +  P+ + +      VS     H+S K
Sbjct: 401 YYRVFIKDFAAIARPITDILKGENGSVSK----HMSKK 434



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   Y QI +A  D  KT+     G YEF  + FGLRNA   FQR +D+
Sbjct: 250 TLDLKSGYHQIYLAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDD 301



 Score = 35.1 bits (77), Expect = 0.089
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 9/50 (18%)
 Frame = +2

Query: 134 NVSKIYRRSYD---------FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           N S I++R+ D          C+ YVDD++++S +   H  H+ T+ K L
Sbjct: 290 NASSIFQRALDDVLREQIGKICYVYVDDVIIFSENESDHVRHIDTVLKCL 339


>EF591042-2|ABQ84943.1| 1045|Drosophila melanogaster pol protein
           protein.
          Length = 1045

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 29/98 (29%), Positives = 54/98 (55%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  + ++  K  F    V +LG  +S DGT+   E+++A++++P P  V  +R F+G+ +
Sbjct: 376 DANMRVSQEKTRFFKESVEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLAS 435

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSK 552
           YYR F+++ A +  P+ + +      VS     H+S K
Sbjct: 436 YYRVFIKDFAAIARPITDILKGENGSVSK----HMSKK 469



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   Y QI +A  D  KT+     G YEF  + FGLRNA   FQR +D+
Sbjct: 285 TLDLKSGYHQIYLAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDD 336



 Score = 35.1 bits (77), Expect = 0.089
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 9/50 (18%)
 Frame = +2

Query: 134 NVSKIYRRSYD---------FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           N S I++R+ D          C+ YVDD++++S +   H  H+ T+ K L
Sbjct: 325 NASSIFQRALDDVLREQIGKICYVYVDDVIIFSENESDHVRHIDTVLKCL 374


>DQ887187-2|ABI48306.1| 1010|Drosophila melanogaster pol protein
           protein.
          Length = 1010

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 29/98 (29%), Positives = 54/98 (55%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  + ++  K  F    V +LG  +S DGT+   E+++A++++P P  V  +R F+G+ +
Sbjct: 341 DANMRVSQEKTRFFKESVEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLAS 400

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSK 552
           YYR F+++ A +  P+ + +      VS     H+S K
Sbjct: 401 YYRVFIKDFAAIARPITDILKGENGSVSK----HMSKK 434



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   Y QI +A  D  KT+     G YEF  + FGLRNA   FQR +D+
Sbjct: 250 TLDLKSGYHQIYLAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDD 301



 Score = 35.1 bits (77), Expect = 0.089
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 9/50 (18%)
 Frame = +2

Query: 134 NVSKIYRRSYD---------FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           N S I++R+ D          C+ YVDD++++S +   H  H+ T+ K L
Sbjct: 290 NASSIFQRALDDVLREQIGKICYVYVDDVIIFSENESDHVRHIDTVLKCL 339


>DQ887186-2|ABI48303.1| 1010|Drosophila melanogaster pol protein
           protein.
          Length = 1010

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 29/98 (29%), Positives = 54/98 (55%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  + ++  K  F    V +LG  +S DGT+   E+++A++++P P  V  +R F+G+ +
Sbjct: 341 DANMRVSQEKTRFFKESVEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLAS 400

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSK 552
           YYR F+++ A +  P+ + +      VS     H+S K
Sbjct: 401 YYRVFIKDFAAIARPITDILKGENGSVSK----HMSKK 434



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   Y QI +A  D  KT+     G YEF  + FGLRNA   FQR +D+
Sbjct: 250 TLDLKSGYHQIYLAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDD 301



 Score = 35.1 bits (77), Expect = 0.089
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 9/50 (18%)
 Frame = +2

Query: 134 NVSKIYRRSYD---------FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           N S I++R+ D          C+ YVDD++++S +   H  H+ T+ K L
Sbjct: 290 NASSIFQRALDDVLREQIGKICYVYVDDVIIFSENESDHVRHIDTVLKCL 339


>AF033821-2|AAC82604.1| 1463|Drosophila melanogaster Prgag-pol
            protein.
          Length = 1463

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 29/98 (29%), Positives = 54/98 (55%)
 Frame = +1

Query: 259  DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
            D  + ++  K  F    V +LG  +S DGT+   E+++A++++P P  V  +R F+G+ +
Sbjct: 794  DANMRVSQEKTRFFKESVEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLAS 853

Query: 439  YYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSK 552
            YYR F+++ A +  P+ + +      VS     H+S K
Sbjct: 854  YYRVFIKDFAAIARPITDILKGENGSVSK----HMSKK 887



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   Y QI +A  D  KT+     G YEF  + FGLRNA   FQR +D+
Sbjct: 703 TLDLKSGYHQIYLAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDD 754



 Score = 35.1 bits (77), Expect = 0.089
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 9/50 (18%)
 Frame = +2

Query: 134 NVSKIYRRSYD---------FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           N S I++R+ D          C+ YVDD++++S +   H  H+ T+ K L
Sbjct: 743 NASSIFQRALDDVLREQIGKICYVYVDDVIIFSENESDHVRHIDTVLKCL 792


>EF591043-2|ABQ84946.1| 1045|Drosophila melanogaster pol protein
           protein.
          Length = 1045

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 29/98 (29%), Positives = 53/98 (54%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  + ++  K  F    V +LG  +S DGT    E+++A++++P P  V  +R F+G+ +
Sbjct: 376 DANMRVSQEKTRFFTESVEYLGFIVSKDGTISDPEKVKAIQEYPEPDCVYKVRSFLGLAS 435

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSK 552
           YYR F+++ A +  P+ + +      VS     H+S K
Sbjct: 436 YYRVFIKDFAAIARPITDILKGENGSVSK----HMSKK 469



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   Y QI +A  D  KT+     G YEF  + FGLRNA   FQR +D+
Sbjct: 285 TLDLKSGYHQIYLAEHDREKTSFSVNGGKYEFCRLPFGLRNASSIFQRALDD 336



 Score = 35.1 bits (77), Expect = 0.089
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 9/50 (18%)
 Frame = +2

Query: 134 NVSKIYRRSYD---------FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           N S I++R+ D          C+ YVDD++++S +   H  H+ T+ K L
Sbjct: 325 NASSIFQRALDDVLREQIGKICYVYVDDVIIFSENESDHVRHIDTVLKCL 374


>AF541947-2|AAN34648.1|  407|Drosophila melanogaster truncated pol
           protein protein.
          Length = 407

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 26/51 (50%), Positives = 30/51 (58%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           TIDL   + QI + P D  KTA     G YEF  M FGL+NA  TFQR +D
Sbjct: 277 TIDLASGFHQIQMNPRDASKTAFTVENGHYEFTRMPFGLKNAPATFQRVMD 327



 Score = 35.9 bits (79), Expect = 0.051
 Identities = 16/45 (35%), Positives = 28/45 (62%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVL 304
           C  Y+DDI+V+S    +H A ++++F +L+   +L IQ + C  L
Sbjct: 338 CLVYLDDIIVFSPSLQKHIADIKSVFTKLQ-NANLKIQPSKCSFL 381



 Score = 35.5 bits (78), Expect = 0.067
 Identities = 14/45 (31%), Positives = 27/45 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQAL 378
           F  +++  + I P+KC F   E+ FLG+ ++ +G +P   +IQ +
Sbjct: 363 FTKLQNANLKIQPSKCSFLRKEIDFLGHIVTQEGVKPNPLKIQTI 407


>Z27119-1|CAA81643.1| 1333|Drosophila melanogaster blastopia
           polyprotein protein.
          Length = 1333

 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 23/80 (28%), Positives = 43/80 (53%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++G+ I   KC F    + FLG+ I      P  E+  A+  F  PQ V+ ++ F+G+  
Sbjct: 668 EFGLKIKWKKCNFMQRRIHFLGHIIEGGQICPGKEKTSAVNSFGTPQNVKAVQGFLGLTG 727

Query: 439 YYRRFLRNAAKLQAPLVNAI 498
           ++R+F+   A++  PL + +
Sbjct: 728 FFRKFIPGYAQIARPLTDLL 747



 Score = 37.1 bits (82), Expect = 0.022
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           T+DL   +  + V       TA +T  GL+EFN   FG +N+   F RF+
Sbjct: 576 TMDLQNGFFHVAVEEASKPYTAFVTREGLFEFNKAPFGFKNSPAAFIRFV 625


>AY050234-1|AAK84933.1| 1026|Drosophila melanogaster SD02026p
           protein.
          Length = 1026

 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 23/80 (28%), Positives = 43/80 (53%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++G+ I   KC F    + FLG+ I      P  E+  A+  F  PQ V+ ++ F+G+  
Sbjct: 362 EFGLKIKWKKCNFMQRRIHFLGHIIEGGQICPGKEKTSAVNSFGTPQNVKAVQGFLGLTG 421

Query: 439 YYRRFLRNAAKLQAPLVNAI 498
           ++R+F+   A++  PL + +
Sbjct: 422 FFRKFIPGYAQIARPLTDLL 441



 Score = 37.1 bits (82), Expect = 0.022
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           T+DL   +  + V       TA +T  GL+EFN   FG +N+   F RF+
Sbjct: 270 TMDLQNGFFHVAVEEASKPYTAFVTREGLFEFNKAPFGFKNSPAAFIRFV 319


>U89994-2|AAB50148.1| 1041|Drosophila melanogaster reverse
           transcriptase polyprotein protein.
          Length = 1041

 Score = 49.6 bits (113), Expect = 4e-06
 Identities = 22/83 (26%), Positives = 44/83 (53%)
 Frame = +1

Query: 274 INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRF 453
           ++  K  F    V +LG  +S+ G      +++A++ +  P  +  +R F+G+ +YYR F
Sbjct: 377 VSKEKSFFFKESVEYLGFMVSSGGITTSPSKVEAIQKYNQPTNLFSVRSFLGLASYYRCF 436

Query: 454 LRNAAKLQAPLVNAIVATEVKVS 522
           +++ A +  PL + +     KVS
Sbjct: 437 IKDFASIARPLTDILKGENGKVS 459



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL  A+ QI +A +D  KTA     G YEF  + FGL+NA   FQR ID+
Sbjct: 281 TLDLKSAFHQILLAEKDRAKTAFSVGNGKYEFCRLPFGLKNAPSIFQRAIDD 332


>X52759-1|CAA36970.1|  365|Drosophila melanogaster glutamine
           synthetase protein.
          Length = 365

 Score = 28.7 bits (61), Expect = 7.7
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -2

Query: 560 KAFFELRCPSDRCETFTSVATIALT 486
           K +FE RCPS  C+ ++ V  I  T
Sbjct: 336 KGYFEDRCPSSNCDPYSVVEAILRT 360


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,063,294
Number of Sequences: 53049
Number of extensions: 575808
Number of successful extensions: 1595
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1488
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1595
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2951284050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -