SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-4234|AAF56792.1|  421|Drosophila melanogaster CG1894-PA...    29   4.6  
L05109-1|AAA70421.1|  632|Drosophila melanogaster poly(A)-bindin...    29   8.1  
AY118528-1|AAM49897.1|  634|Drosophila melanogaster LD24412p pro...    29   8.1  
AE013599-2628|AAS64811.1|  634|Drosophila melanogaster CG5119-PH...    29   8.1  
AE013599-2627|AAM68178.1|  634|Drosophila melanogaster CG5119-PG...    29   8.1  
AE013599-2626|AAF57747.1|  634|Drosophila melanogaster CG5119-PF...    29   8.1  
AE013599-2625|AAM68177.1|  634|Drosophila melanogaster CG5119-PE...    29   8.1  
AE013599-2624|AAM68176.1|  634|Drosophila melanogaster CG5119-PD...    29   8.1  
AE013599-2623|AAF57746.1|  634|Drosophila melanogaster CG5119-PC...    29   8.1  
AE013599-2622|AAF57745.1|  634|Drosophila melanogaster CG5119-PB...    29   8.1  
AE013599-2621|AAM68175.1|  634|Drosophila melanogaster CG5119-PA...    29   8.1  

>AE014297-4234|AAF56792.1|  421|Drosophila melanogaster CG1894-PA
           protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = -3

Query: 246 VVSPPTRCTYICIFYPR-VCLQRLYNFHILNC-WRCP 142
           V++      Y+C F  + +CL++ Y++H+ +C  RCP
Sbjct: 166 VINDKATTIYVCEFCLKYMCLRKSYSYHLYDCKKRCP 202


>L05109-1|AAA70421.1|  632|Drosophila melanogaster poly(A)-binding
           protein protein.
          Length = 632

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 278 RHESVFGVNLYVKNLDDTID 297


>AY118528-1|AAM49897.1|  634|Drosophila melanogaster LD24412p
           protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


>AE013599-2628|AAS64811.1|  634|Drosophila melanogaster CG5119-PH,
           isoform H protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


>AE013599-2627|AAM68178.1|  634|Drosophila melanogaster CG5119-PG,
           isoform G protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


>AE013599-2626|AAF57747.1|  634|Drosophila melanogaster CG5119-PF,
           isoform F protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


>AE013599-2625|AAM68177.1|  634|Drosophila melanogaster CG5119-PE,
           isoform E protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


>AE013599-2624|AAM68176.1|  634|Drosophila melanogaster CG5119-PD,
           isoform D protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


>AE013599-2623|AAF57746.1|  634|Drosophila melanogaster CG5119-PC,
           isoform C protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


>AE013599-2622|AAF57745.1|  634|Drosophila melanogaster CG5119-PB,
           isoform B protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


>AE013599-2621|AAM68175.1|  634|Drosophila melanogaster CG5119-PA,
           isoform A protein.
          Length = 634

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -1

Query: 626 RHLQVFGLNLLVLNCDDAFD 567
           RH  VFG+NL V N DD  D
Sbjct: 280 RHESVFGVNLYVKNLDDTID 299


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,898,705
Number of Sequences: 53049
Number of extensions: 635577
Number of successful extensions: 1671
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1606
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1671
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3087795150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -