SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X52846-1|CAA37037.1|  575|Drosophila melanogaster protein ( Dros...   163   3e-40
BT015209-1|AAT94438.1|  575|Drosophila melanogaster RE56857p pro...   163   3e-40
BT011476-1|AAR99134.1|  719|Drosophila melanogaster RE11923p pro...   163   3e-40
BT001716-1|AAN71471.1|  578|Drosophila melanogaster RE68337p pro...   163   3e-40
AE014297-394|AAG22212.1|  578|Drosophila melanogaster CG10279-PF...   163   3e-40
AE014297-393|AAN14332.1|  578|Drosophila melanogaster CG10279-PC...   163   3e-40
AE014297-392|AAF51926.2|  578|Drosophila melanogaster CG10279-PB...   163   3e-40
AE014297-391|AAF51927.2|  578|Drosophila melanogaster CG10279-PE...   163   3e-40
AE014297-390|AAN14331.1|  575|Drosophila melanogaster CG10279-PD...   163   3e-40
AE014297-389|AAG22213.2|  719|Drosophila melanogaster CG10279-PA...   163   3e-40
AY102660-1|AAM27489.1|  818|Drosophila melanogaster GH10652p pro...   157   1e-38
AE014296-1163|AAF50635.2|  818|Drosophila melanogaster CG10077-P...   157   1e-38
AY060404-1|AAL25443.1|  945|Drosophila melanogaster LD32873p pro...   155   4e-38
AE014298-1087|AAF46295.1|  945|Drosophila melanogaster CG10777-P...   155   4e-38
AY051831-1|AAK93255.1|  703|Drosophila melanogaster LD33749p pro...   110   1e-24
AY069298-1|AAL39443.1|  157|Drosophila melanogaster HL01868p pro...   105   4e-23
AE014296-1164|AAN12065.1|  157|Drosophila melanogaster CG10077-P...   105   4e-23
AY061400-1|AAL28948.1|  791|Drosophila melanogaster LD32732p pro...    99   5e-21
AE014296-1853|AAF50131.1|  791|Drosophila melanogaster CG6418-PB...    99   5e-21
BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p pro...    97   2e-20
AY058515-1|AAL13744.1|  680|Drosophila melanogaster LD21880p pro...    97   2e-20
AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA...    97   2e-20
AE014297-778|AAF54262.1|  798|Drosophila melanogaster CG9748-PA ...    96   5e-20
AY089613-1|AAL90351.1|  798|Drosophila melanogaster RE28061p pro...    94   2e-19
X12945-1|CAA31405.1|  661|Drosophila melanogaster vasa protein.        84   2e-16
M23560-1|AAA29013.1|  648|Drosophila melanogaster protein ( D.me...    83   5e-16
AY084126-1|AAL89864.1|  376|Drosophila melanogaster RE20606p pro...    83   5e-16
AE014134-2564|AAF53438.1|  661|Drosophila melanogaster CG3506-PA...    83   5e-16
AY051752-1|AAK93176.1|  619|Drosophila melanogaster LD28839p pro...    81   1e-15
AF212866-1|AAF19985.1|  619|Drosophila melanogaster abstrakt pro...    81   1e-15
AF187729-1|AAF04040.1|  614|Drosophila melanogaster DEAD-box pro...    81   1e-15
AE014297-15|AAF52165.1|  619|Drosophila melanogaster CG14637-PA ...    81   1e-15
BT021222-1|AAX33370.1|  822|Drosophila melanogaster RH55640p pro...    78   1e-14
AY060822-1|AAL28370.1|  641|Drosophila melanogaster GM01081p pro...    78   1e-14
AE014134-2947|AAF53680.2|  822|Drosophila melanogaster CG10333-P...    78   1e-14
AE014298-914|AAF46176.1|  438|Drosophila melanogaster CG14443-PA...    75   9e-14
AY121677-1|AAM52004.1|  507|Drosophila melanogaster RE27528p pro...    68   1e-11
AE014134-3342|AAF53963.1|  507|Drosophila melanogaster CG9253-PA...    68   1e-11
M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase p...    67   2e-11
AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p pro...    67   2e-11
AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB...    67   2e-11
AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA...    67   2e-11
AY119628-1|AAM50282.1|  826|Drosophila melanogaster RE19835p pro...    64   2e-10
AE014298-2591|AAF48747.2|  826|Drosophila melanogaster CG5800-PA...    64   2e-10
AF145609-1|AAD38584.1|  974|Drosophila melanogaster BcDNA.GH0283...    61   2e-09
AE014298-2568|AAO41693.1|  975|Drosophila melanogaster CG8611-PB...    61   2e-09
AE014298-2567|AAF48727.2|  974|Drosophila melanogaster CG8611-PA...    61   2e-09
AY121623-1|AAM51950.1|  403|Drosophila melanogaster GH17619p pro...    58   1e-08
AY089635-1|AAL90373.1|  399|Drosophila melanogaster RE50350p pro...    58   1e-08
AY069283-1|AAL39428.1|  403|Drosophila melanogaster GM14109p pro...    58   1e-08
AF145621-1|AAD38596.1|  403|Drosophila melanogaster eukaryotic i...    58   1e-08
AE014297-735|AAF54221.1|  399|Drosophila melanogaster CG7483-PA ...    58   1e-08
AE014134-1011|AAN10568.1|  403|Drosophila melanogaster CG9075-PD...    58   1e-08
AE014134-1010|AAN10567.1|  403|Drosophila melanogaster CG9075-PB...    58   1e-08
AE014134-1009|AAN10566.1|  403|Drosophila melanogaster CG9075-PC...    58   1e-08
AE014134-1008|AAF52317.2|  403|Drosophila melanogaster CG9075-PA...    58   1e-08
BT004908-1|AAO49161.1|  782|Drosophila melanogaster LD15481p pro...    56   3e-08
AF181659-1|AAD55444.1|  641|Drosophila melanogaster BcDNA.GM0530...    56   3e-08
AE013599-611|AAF59119.1|  782|Drosophila melanogaster CG2173-PA ...    56   3e-08
AY075397-1|AAL68229.1|  827|Drosophila melanogaster LD28101p pro...    55   1e-07
AE014296-83|AAN11439.1|  827|Drosophila melanogaster CG32344-PA ...    55   1e-07
X69045-1|CAA48790.1|  402|Drosophila melanogaster eukaryotic tra...    54   1e-07
U84552-1|AAC27683.1|  663|Drosophila melanogaster helicase pitch...    53   4e-07
AY119620-1|AAM50274.1|  680|Drosophila melanogaster LD46167p pro...    53   4e-07
AY071402-1|AAL49024.1|  680|Drosophila melanogaster RE48840p pro...    53   4e-07
AE014297-3091|AAN13900.2|  680|Drosophila melanogaster CG6375-PB...    53   4e-07
AE014297-3090|AAF55951.2|  680|Drosophila melanogaster CG6375-PA...    53   4e-07
AY051513-1|AAK92937.1|  613|Drosophila melanogaster GH16590p pro...    49   7e-06
AE014297-721|AAF54208.1|  613|Drosophila melanogaster CG9630-PA ...    49   7e-06
Z23266-1|CAA80804.1|  527|Drosophila melanogaster DEAD-box prote...    47   3e-05
L13612-1|AAA16339.1|  527|Drosophila melanogaster DEAD-box prote...    47   3e-05
AY058728-1|AAL13957.1|  521|Drosophila melanogaster LD47509p pro...    47   3e-05
AE013599-778|AAF58994.1|  521|Drosophila melanogaster CG12759-PA...    47   3e-05
AE014296-2963|AAF49303.1|  594|Drosophila melanogaster CG5589-PA...    45   1e-04
X79802-1|CAA56197.1|  424|Drosophila melanogaster WM6 protein.         44   2e-04
L06018-1|AAB65835.1|  424|Drosophila melanogaster DECD family pu...    44   2e-04
AY118921-1|AAM50781.1|  424|Drosophila melanogaster LD23644p pro...    44   2e-04
AE014134-934|AAN10545.1|  424|Drosophila melanogaster CG7269-PC,...    44   2e-04
AE014134-933|AAN10544.1|  424|Drosophila melanogaster CG7269-PB,...    44   2e-04
AE014134-932|AAF52261.1|  424|Drosophila melanogaster CG7269-PA,...    44   2e-04
AY058512-1|AAL13741.1|  536|Drosophila melanogaster LD21669p pro...    42   6e-04
AE014134-152|AAF51458.1|  536|Drosophila melanogaster CG3561-PA ...    42   6e-04
AY119661-1|AAM50315.1|  727|Drosophila melanogaster SD05527p pro...    40   0.004
AE014296-3658|AAF51814.1|  727|Drosophila melanogaster CG9054-PA...    40   0.004
U34773-1|AAC47309.1|  725|Drosophila melanogaster DEAD-box prote...    39   0.006
BT010296-1|AAQ23614.1|  813|Drosophila melanogaster LD11580p pro...    39   0.007
AE013599-2990|AAF57487.1|  813|Drosophila melanogaster CG9143-PA...    39   0.007
AY071389-1|AAL49011.1|  288|Drosophila melanogaster RE44177p pro...    38   0.010
AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box hel...    38   0.010
AY113641-1|AAM29646.1|  388|Drosophila melanogaster RH74035p pro...    38   0.017
AY070624-1|AAL48095.1|  560|Drosophila melanogaster RE72861p pro...    37   0.022
AF017777-10|AAC28406.1|  560|Drosophila melanogaster helicase pr...    37   0.022
AE014298-3138|AAF50818.2|  560|Drosophila melanogaster CG1666-PA...    37   0.022
AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD0556...    36   0.039
AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA...    36   0.039
M74824-1|AAC14192.1|  644|Drosophila melanogaster D-E-A-D box pr...    32   0.83 
BT010045-1|AAQ22514.1|  687|Drosophila melanogaster LD27814p pro...    32   0.83 
AF132173-1|AAD34761.1|  687|Drosophila melanogaster unknown prot...    32   0.83 
AE014296-2792|AAF49419.1|  687|Drosophila melanogaster CG9680-PA...    32   0.83 
BT029142-1|ABJ17075.1| 1613|Drosophila melanogaster RE40504p pro...    30   3.4  
AE013599-3459|AAF46896.3| 1622|Drosophila melanogaster CG30092-P...    30   3.4  
AE013599-3458|AAF46895.4| 2964|Drosophila melanogaster CG30092-P...    30   3.4  
AE013599-3630|AAF47029.1| 1000|Drosophila melanogaster CG5372-PA...    29   7.8  

>X52846-1|CAA37037.1|  575|Drosophila melanogaster protein (
           Drosophila melanogasterRM62 mRNA for novel RNA helicase.
           ).
          Length = 575

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 269 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 328

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 329 VKQLAEDFLGNYIQINIGSLELSA 352



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 184 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 243

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 244 VFGGAPKGGQMRDLQRGCEIVIAT 267



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 353 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 399


>BT015209-1|AAT94438.1|  575|Drosophila melanogaster RE56857p
           protein.
          Length = 575

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 269 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 328

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 329 VKQLAEDFLGNYIQINIGSLELSA 352



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 184 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 243

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 244 VFGGAPKGGQMRDLQRGCEIVIAT 267



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 353 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 399


>BT011476-1|AAR99134.1|  719|Drosophila melanogaster RE11923p
           protein.
          Length = 719

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 413 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 472

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 473 VKQLAEDFLGNYIQINIGSLELSA 496



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 328 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 387

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 388 VFGGAPKGGQMRDLQRGCEIVIAT 411



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 497 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 543


>BT001716-1|AAN71471.1|  578|Drosophila melanogaster RE68337p
           protein.
          Length = 578

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 272 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 331

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 332 VKQLAEDFLGNYIQINIGSLELSA 355



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 187 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 246

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 247 VFGGAPKGGQMRDLQRGCEIVIAT 270



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 356 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 402


>AE014297-394|AAG22212.1|  578|Drosophila melanogaster CG10279-PF,
           isoform F protein.
          Length = 578

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 272 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 331

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 332 VKQLAEDFLGNYIQINIGSLELSA 355



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 187 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 246

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 247 VFGGAPKGGQMRDLQRGCEIVIAT 270



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 356 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 402


>AE014297-393|AAN14332.1|  578|Drosophila melanogaster CG10279-PC,
           isoform C protein.
          Length = 578

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 272 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 331

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 332 VKQLAEDFLGNYIQINIGSLELSA 355



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 187 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 246

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 247 VFGGAPKGGQMRDLQRGCEIVIAT 270



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 356 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 402


>AE014297-392|AAF51926.2|  578|Drosophila melanogaster CG10279-PB,
           isoform B protein.
          Length = 578

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 272 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 331

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 332 VKQLAEDFLGNYIQINIGSLELSA 355



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 187 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 246

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 247 VFGGAPKGGQMRDLQRGCEIVIAT 270



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 356 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 402


>AE014297-391|AAF51927.2|  578|Drosophila melanogaster CG10279-PE,
           isoform E protein.
          Length = 578

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 272 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 331

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 332 VKQLAEDFLGNYIQINIGSLELSA 355



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 187 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 246

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 247 VFGGAPKGGQMRDLQRGCEIVIAT 270



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 356 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 402


>AE014297-390|AAN14331.1|  575|Drosophila melanogaster CG10279-PD,
           isoform D protein.
          Length = 575

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 269 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 328

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 329 VKQLAEDFLGNYIQINIGSLELSA 352



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 184 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 243

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 244 VFGGAPKGGQMRDLQRGCEIVIAT 267



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 353 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 399


>AE014297-389|AAG22213.2|  719|Drosophila melanogaster CG10279-PA,
           isoform A protein.
          Length = 719

 Score =  163 bits (395), Expect = 3e-40
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 413 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 472

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 473 VKQLAEDFLGNYIQINIGSLELSA 496



 Score =  150 bits (363), Expect = 2e-36
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 328 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 387

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 388 VFGGAPKGGQMRDLQRGCEIVIAT 411



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 497 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 543


>AY102660-1|AAM27489.1|  818|Drosophila melanogaster GH10652p
           protein.
          Length = 818

 Score =  157 bits (381), Expect = 1e-38
 Identities = 70/84 (83%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE+GTT+L+RCTYLVLDEADRMLDMGFEPQIRKI++QIRPDRQ LMWSATWPKE
Sbjct: 289 GRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKE 348

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAE++L +YIQ+NIGSL LSA
Sbjct: 349 VRQLAEEFLNNYIQVNIGSLSLSA 372



 Score =  152 bits (369), Expect = 4e-37
 Identities = 70/84 (83%), Positives = 78/84 (92%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPA+VHINNQP + RGDGPIALVLAPTRELAQQIQQVA +FG  ++VRNTC
Sbjct: 204 GSGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFGSNTHVRNTC 263

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGGAPK +QARDLERGVEIVIAT
Sbjct: 264 IFGGAPKGQQARDLERGVEIVIAT 287



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 29/47 (61%), Positives = 35/47 (74%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNILQIVD+C E+EK  KL  LL +I  S E   KTIIFVETK+++
Sbjct: 373 NHNILQIVDVCDENEKLMKLIKLLTDI--SAENETKTIIFVETKKRV 417


>AE014296-1163|AAF50635.2|  818|Drosophila melanogaster CG10077-PA,
           isoform A protein.
          Length = 818

 Score =  157 bits (381), Expect = 1e-38
 Identities = 70/84 (83%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE+GTT+L+RCTYLVLDEADRMLDMGFEPQIRKI++QIRPDRQ LMWSATWPKE
Sbjct: 289 GRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKE 348

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAE++L +YIQ+NIGSL LSA
Sbjct: 349 VRQLAEEFLNNYIQVNIGSLSLSA 372



 Score =  152 bits (369), Expect = 4e-37
 Identities = 70/84 (83%), Positives = 78/84 (92%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPA+VHINNQP + RGDGPIALVLAPTRELAQQIQQVA +FG  ++VRNTC
Sbjct: 204 GSGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFGSNTHVRNTC 263

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGGAPK +QARDLERGVEIVIAT
Sbjct: 264 IFGGAPKGQQARDLERGVEIVIAT 287



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 29/47 (61%), Positives = 35/47 (74%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNILQIVD+C E+EK  KL  LL +I  S E   KTIIFVETK+++
Sbjct: 373 NHNILQIVDVCDENEKLMKLIKLLTDI--SAENETKTIIFVETKKRV 417


>AY060404-1|AAL25443.1|  945|Drosophila melanogaster LD32873p
           protein.
          Length = 945

 Score =  155 bits (377), Expect = 4e-38
 Identities = 78/112 (69%), Positives = 85/112 (75%), Gaps = 1/112 (0%)
 Frame = +2

Query: 176 HVCVWWCS*K-RASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG 352
           H C++  S K   +  L  G        GRLIDFLE   TNLQRCTYLVLDEADRMLDMG
Sbjct: 343 HTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLENRNTNLQRCTYLVLDEADRMLDMG 402

Query: 353 FEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           FEPQIRKIIEQIRPDRQ +MWSATWPKEV+ LA D+L DYIQINIGS+ LSA
Sbjct: 403 FEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNLSA 454



 Score =  133 bits (321), Expect = 2e-31
 Identities = 63/86 (73%), Positives = 73/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH--TSYVRN 176
           GSGKTLAY+LPAIVHI NQPPI RG+GPIALVLAPTRELAQQIQ V  D+GH     +R+
Sbjct: 284 GSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSVVRDYGHLCKPEIRH 343

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
           TC+FGG+ K  QARDL+RGVE++IAT
Sbjct: 344 TCIFGGSSKVPQARDLDRGVEVIIAT 369



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 3/50 (6%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIG---QSQEPGAKTIIFVETKRKL 648
           NHNI QIV+IC E EK  +L  LL EI     S   G K I+FVETK K+
Sbjct: 455 NHNIRQIVEICTEIEKPQRLVCLLNEISPIKNSGNNGNKIIVFVETKIKV 504


>AE014298-1087|AAF46295.1|  945|Drosophila melanogaster CG10777-PB
           protein.
          Length = 945

 Score =  155 bits (377), Expect = 4e-38
 Identities = 78/112 (69%), Positives = 85/112 (75%), Gaps = 1/112 (0%)
 Frame = +2

Query: 176 HVCVWWCS*K-RASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMG 352
           H C++  S K   +  L  G        GRLIDFLE   TNLQRCTYLVLDEADRMLDMG
Sbjct: 343 HTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLENRNTNLQRCTYLVLDEADRMLDMG 402

Query: 353 FEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           FEPQIRKIIEQIRPDRQ +MWSATWPKEV+ LA D+L DYIQINIGS+ LSA
Sbjct: 403 FEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNLSA 454



 Score =  133 bits (321), Expect = 2e-31
 Identities = 63/86 (73%), Positives = 73/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH--TSYVRN 176
           GSGKTLAY+LPAIVHI NQPPI RG+GPIALVLAPTRELAQQIQ V  D+GH     +R+
Sbjct: 284 GSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSVVRDYGHLCKPEIRH 343

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
           TC+FGG+ K  QARDL+RGVE++IAT
Sbjct: 344 TCIFGGSSKVPQARDLDRGVEVIIAT 369



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 3/50 (6%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIG---QSQEPGAKTIIFVETKRKL 648
           NHNI QIV+IC E EK  +L  LL EI     S   G K I+FVETK K+
Sbjct: 455 NHNIRQIVEICTEIEKPQRLVCLLNEISPIKNSGNNGNKIIVFVETKIKV 504


>AY051831-1|AAK93255.1|  703|Drosophila melanogaster LD33749p
           protein.
          Length = 703

 Score =  110 bits (265), Expect = 1e-24
 Identities = 53/96 (55%), Positives = 68/96 (70%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L  G+    C  GRL D +     ++   TYLVLDEADRMLDMGFEPQIRK++  IRPDR
Sbjct: 403 LERGAEIIICTPGRLNDLIMANVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPDR 462

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           QT+M SATWP  V++LA+ Y+ + IQ+ +GSL L+A
Sbjct: 463 QTIMTSATWPPGVRRLAQSYMKNPIQVCVGSLDLAA 498



 Score = 71.7 bits (168), Expect = 8e-13
 Identities = 40/86 (46%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR--RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           G+GKTLA++LP ++H   Q   R  RG G   LVLAPTRELA QI+     +     ++ 
Sbjct: 330 GTGKTLAFLLPGMIHTEYQSTPRGTRG-GANVLVLAPTRELALQIEMEVKKYSFRG-MKA 387

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
            CV+GG  +  Q  DLERG EI+I T
Sbjct: 388 VCVYGGGNRNMQISDLERGAEIIICT 413


>AY069298-1|AAL39443.1|  157|Drosophila melanogaster HL01868p
           protein.
          Length = 157

 Score =  105 bits (253), Expect = 4e-23
 Identities = 46/57 (80%), Positives = 54/57 (94%)
 Frame = +2

Query: 338 MLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           MLDMGFEPQIRKI++QIRPDRQ LMWSATWPKEV++LAE++L +YIQ+NIGSL LSA
Sbjct: 1   MLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSA 57



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 29/47 (61%), Positives = 35/47 (74%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNILQIVD+C E+EK  KL  LL +I  S E   KTIIFVETK+++
Sbjct: 58  NHNILQIVDVCDENEKLMKLIKLLTDI--SAENETKTIIFVETKKRV 102


>AE014296-1164|AAN12065.1|  157|Drosophila melanogaster CG10077-PB,
           isoform B protein.
          Length = 157

 Score =  105 bits (253), Expect = 4e-23
 Identities = 46/57 (80%), Positives = 54/57 (94%)
 Frame = +2

Query: 338 MLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           MLDMGFEPQIRKI++QIRPDRQ LMWSATWPKEV++LAE++L +YIQ+NIGSL LSA
Sbjct: 1   MLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSA 57



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 29/47 (61%), Positives = 35/47 (74%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNILQIVD+C E+EK  KL  LL +I  S E   KTIIFVETK+++
Sbjct: 58  NHNILQIVDVCDENEKLMKLIKLLTDI--SAENETKTIIFVETKKRV 102


>AY061400-1|AAL28948.1|  791|Drosophila melanogaster LD32732p
           protein.
          Length = 791

 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           S  L +G+       GR+ID ++   TNL+R T+LVLDEADRM  MGFEPQ+R I   +R
Sbjct: 386 SKALEQGAEIIVATPGRMIDMVKMKATNLRRVTFLVLDEADRMFHMGFEPQVRSICNHVR 445

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           PDRQ LM+SAT+ K +++LA D L D ++I  G L
Sbjct: 446 PDRQCLMFSATFKKRIERLARDVLSDPVRIVQGDL 480



 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 41/84 (48%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I P ++H+ +Q  ++ GDGPI L+LAPTREL+ QI   A  FG    +   C
Sbjct: 316 GSGKTAAFIWPMLMHVMDQKQLKPGDGPIGLILAPTRELSLQIYNEAKKFGKVYNLNVVC 375

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GG  K EQ++ LE+G EI++AT
Sbjct: 376 CYGGGSKWEQSKALEQGAEIIVAT 399


>AE014296-1853|AAF50131.1|  791|Drosophila melanogaster CG6418-PB
           protein.
          Length = 791

 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           S  L +G+       GR+ID ++   TNL+R T+LVLDEADRM  MGFEPQ+R I   +R
Sbjct: 386 SKALEQGAEIIVATPGRMIDMVKMKATNLRRVTFLVLDEADRMFHMGFEPQVRSICNHVR 445

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           PDRQ LM+SAT+ K +++LA D L D ++I  G L
Sbjct: 446 PDRQCLMFSATFKKRIERLARDVLSDPVRIVQGDL 480



 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 41/84 (48%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I P ++H+ +Q  ++ GDGPI L+LAPTREL+ QI   A  FG    +   C
Sbjct: 316 GSGKTAAFIWPMLMHVMDQKQLKPGDGPIGLILAPTRELSLQIYNEAKKFGKVYNLNVVC 375

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GG  K EQ++ LE+G EI++AT
Sbjct: 376 CYGGGSKWEQSKALEQGAEIIVAT 399


>BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p
           protein.
          Length = 1224

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/93 (50%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TY+VLDEADRM DMGFEPQ+ +II+ +R
Sbjct: 630 LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVR 689

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P++++ LA   L   I++ +G
Sbjct: 690 PDRQTVMFSATFPRQMEALARRILKKPIEVIVG 722



 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 41/84 (48%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ILP   HI +QP +  GDG IA+++APTREL  QI +    F  +  +R  C
Sbjct: 557 GSGKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVC 616

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQ  +L+RG EI++ T
Sbjct: 617 VYGGTGISEQIAELKRGAEIIVCT 640


>AY058515-1|AAL13744.1|  680|Drosophila melanogaster LD21880p
           protein.
          Length = 680

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/93 (50%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TY+VLDEADRM DMGFEPQ+ +II+ +R
Sbjct: 86  LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVR 145

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P++++ LA   L   I++ +G
Sbjct: 146 PDRQTVMFSATFPRQMEALARRILKKPIEVIVG 178



 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 41/84 (48%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ILP   HI +QP +  GDG IA+++APTREL  QI +    F  +  +R  C
Sbjct: 13  GSGKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVC 72

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQ  +L+RG EI++ T
Sbjct: 73  VYGGTGISEQIAELKRGAEIIVCT 96


>AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA
           protein.
          Length = 1224

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/93 (50%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TY+VLDEADRM DMGFEPQ+ +II+ +R
Sbjct: 630 LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVR 689

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P++++ LA   L   I++ +G
Sbjct: 690 PDRQTVMFSATFPRQMEALARRILKKPIEVIVG 722



 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 41/84 (48%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ILP   HI +QP +  GDG IA+++APTREL  QI +    F  +  +R  C
Sbjct: 557 GSGKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVC 616

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQ  +L+RG EI++ T
Sbjct: 617 VYGGTGISEQIAELKRGAEIIVCT 640


>AE014297-778|AAF54262.1|  798|Drosophila melanogaster CG9748-PA
           protein.
          Length = 798

 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 45/82 (54%), Positives = 62/82 (75%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR----PDRQTLMWSAT 424
           GRL D + +G   L+   +LVLDEADRMLDMGFEPQIR+I+EQ+       RQTLM+SAT
Sbjct: 437 GRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSAT 496

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PK++++LA D+L +YI + +G
Sbjct: 497 FPKQIQELASDFLSNYIFLAVG 518



 Score = 66.5 bits (155), Expect = 3e-11
 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAI---VHINNQPP-------IRRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A+++P +     + + PP        RR   P+ LVLAPTRELA QI + A  F
Sbjct: 342 GSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKF 401

Query: 153 GHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            + S +R   ++GG    EQ R+L+RG  +++AT
Sbjct: 402 AYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVAT 435


>AY089613-1|AAL90351.1|  798|Drosophila melanogaster RE28061p
           protein.
          Length = 798

 Score = 93.9 bits (223), Expect = 2e-19
 Identities = 44/82 (53%), Positives = 61/82 (74%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR----PDRQTLMWSAT 424
           GRL D + +G   L+   +LVLDEADRMLDMGFEPQIR+I+EQ+       RQTLM+SAT
Sbjct: 437 GRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSAT 496

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PK++++LA D+L +Y  + +G
Sbjct: 497 FPKQIQELASDFLSNYTFLAVG 518



 Score = 66.5 bits (155), Expect = 3e-11
 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAI---VHINNQPP-------IRRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A+++P +     + + PP        RR   P+ LVLAPTRELA QI + A  F
Sbjct: 342 GSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKF 401

Query: 153 GHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            + S +R   ++GG    EQ R+L+RG  +++AT
Sbjct: 402 AYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVAT 435


>X12945-1|CAA31405.1|  661|Drosophila melanogaster vasa protein.
          Length = 661

 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 36/80 (45%), Positives = 60/80 (75%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWSATWP 430
           GRL+DF+++     +   ++VLDEADRMLDMGF   +R+I+  +  RP+ QTLM+SAT+P
Sbjct: 377 GRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFP 436

Query: 431 KEVKKLAEDYLGDYIQINIG 490
           +E++++A ++L +Y+ + IG
Sbjct: 437 EEIQRMAGEFLKNYVSVAIG 456



 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 33/84 (39%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  +   P       P  ++++PTRELA QI   A  F   SY++   
Sbjct: 292 GSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGI 351

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG   R Q   + RG  +VIAT
Sbjct: 352 VYGGTSFRHQNECITRGCHVVIAT 375


>M23560-1|AAA29013.1|  648|Drosophila melanogaster protein (
           D.melanogaster antigenMab46F11 (vasa) mRNA, complete
           cds. ).
          Length = 648

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 36/80 (45%), Positives = 60/80 (75%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWSATWP 430
           GRL+DF+++     +   ++VLDEADRMLDMGF   +R+I+  +  RP+ QTLM+SAT+P
Sbjct: 364 GRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFP 423

Query: 431 KEVKKLAEDYLGDYIQINIG 490
           +E++++A ++L +Y+ + IG
Sbjct: 424 EEIQRMAGEFLKNYVFVAIG 443



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  +   P       P   +++PTRELA QI   A  F   SY++   
Sbjct: 279 GSGKTAAFLLPILSKLLEDPHELELGRPQVCIVSPTRELAIQIFNEARKFAFESYLKIGI 338

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG   R Q   + RG  +VIAT
Sbjct: 339 VYGGTSFRHQNECITRGCHVVIAT 362


>AY084126-1|AAL89864.1|  376|Drosophila melanogaster RE20606p
           protein.
          Length = 376

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 36/80 (45%), Positives = 60/80 (75%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWSATWP 430
           GRL+DF+++     +   ++VLDEADRMLDMGF   +R+I+  +  RP+ QTLM+SAT+P
Sbjct: 92  GRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFP 151

Query: 431 KEVKKLAEDYLGDYIQINIG 490
           +E++++A ++L +Y+ + IG
Sbjct: 152 EEIQRMAGEFLKNYVFVAIG 171



 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 33/84 (39%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  +   P       P  ++++PTRELA QI   A  F   SY++   
Sbjct: 7   GSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGI 66

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG   R Q   + RG  +VIAT
Sbjct: 67  VYGGTSFRHQNECITRGCHVVIAT 90


>AE014134-2564|AAF53438.1|  661|Drosophila melanogaster CG3506-PA
           protein.
          Length = 661

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 36/80 (45%), Positives = 60/80 (75%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWSATWP 430
           GRL+DF+++     +   ++VLDEADRMLDMGF   +R+I+  +  RP+ QTLM+SAT+P
Sbjct: 377 GRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFP 436

Query: 431 KEVKKLAEDYLGDYIQINIG 490
           +E++++A ++L +Y+ + IG
Sbjct: 437 EEIQRMAGEFLKNYVFVAIG 456



 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 33/84 (39%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  +   P       P  ++++PTRELA QI   A  F   SY++   
Sbjct: 292 GSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGI 351

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG   R Q   + RG  +VIAT
Sbjct: 352 VYGGTSFRHQNECITRGCHVVIAT 375


>AY051752-1|AAK93176.1|  619|Drosophila melanogaster LD28839p
           protein.
          Length = 619

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 37/78 (47%), Positives = 50/78 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L+K    L  C YL +DEADRM+DMGFE  +R I    +  RQTL++SAT PK+
Sbjct: 318 GRLMDMLDKKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKK 377

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + IN+G
Sbjct: 378 IQNFARSALVKPVTINVG 395



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTS-- 164
           GSGKTL ++LP I+    Q    P  R +GP  L++ P+RELA+Q  ++   +  H    
Sbjct: 224 GSGKTLVFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTHEIIQHYSKHLQAC 283

Query: 165 ---YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
               +R+    GG P  E    + RGV IV+AT
Sbjct: 284 GMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 316


>AF212866-1|AAF19985.1|  619|Drosophila melanogaster abstrakt
           protein protein.
          Length = 619

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 37/78 (47%), Positives = 50/78 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L+K    L  C YL +DEADRM+DMGFE  +R I    +  RQTL++SAT PK+
Sbjct: 318 GRLMDMLDKKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKK 377

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + IN+G
Sbjct: 378 IQNFARSALVKPVTINVG 395



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTS-- 164
           GSGKTL ++LP I+    Q    P  R +GP  L++ P+RELA+Q  ++   +  H    
Sbjct: 224 GSGKTLVFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTHEIIQHYSKHLQAC 283

Query: 165 ---YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
               +R+    GG P  E    + RGV IV+AT
Sbjct: 284 GMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 316


>AF187729-1|AAF04040.1|  614|Drosophila melanogaster DEAD-box
           protein abstrakt protein.
          Length = 614

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 37/78 (47%), Positives = 50/78 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L+K    L  C YL +DEADRM+DMGFE  +R I    +  RQTL++SAT PK+
Sbjct: 313 GRLMDMLDKKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKK 372

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + IN+G
Sbjct: 373 IQNFARSALVKPVTINVG 390



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTS-- 164
           GSGKTL ++LP I+    Q    P  R +GP  L++ P+RELA+Q  ++   +  H    
Sbjct: 219 GSGKTLVFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTHEIIQHYSKHLQAC 278

Query: 165 ---YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
               +R+    GG P  E    + RGV IV+AT
Sbjct: 279 GMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 311


>AE014297-15|AAF52165.1|  619|Drosophila melanogaster CG14637-PA
           protein.
          Length = 619

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 37/78 (47%), Positives = 50/78 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L+K    L  C YL +DEADRM+DMGFE  +R I    +  RQTL++SAT PK+
Sbjct: 318 GRLMDMLDKKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKK 377

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + IN+G
Sbjct: 378 IQNFARSALVKPVTINVG 395



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTS-- 164
           GSGKTL ++LP I+    Q    P  R +GP  L++ P+RELA+Q  ++   +  H    
Sbjct: 224 GSGKTLVFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTHEIIQHYSKHLQAC 283

Query: 165 ---YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
               +R+    GG P  E    + RGV IV+AT
Sbjct: 284 GMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 316


>BT021222-1|AAX33370.1|  822|Drosophila melanogaster RH55640p
           protein.
          Length = 822

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 41/88 (46%), Positives = 53/88 (60%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR----GDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKTLA+++P +  I + P I R      GP A+++APTRELAQQI++    FG    +
Sbjct: 441 GSGKTLAFLIPLLSWIQSLPKIERLEDVDQGPYAIIMAPTRELAQQIEEETTKFGQPLGI 500

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   V GG  + EQ   L  G EIVIAT
Sbjct: 501 RTVVVVGGLSREEQGFRLRLGCEIVIAT 528



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 45/105 (42%), Positives = 60/105 (57%), Gaps = 25/105 (23%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD-------- 397
           GRLID LE     L +CTY+VLDEADRM+DMGFEP ++KI+E      ++PD        
Sbjct: 530 GRLIDVLENRYLVLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDET 589

Query: 398 ------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
                       RQT+M++AT P  V++LA  YL     + IGS+
Sbjct: 590 KLMENFYTKKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSV 634


>AY060822-1|AAL28370.1|  641|Drosophila melanogaster GM01081p
           protein.
          Length = 641

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 41/88 (46%), Positives = 53/88 (60%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR----GDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKTLA+++P +  I + P I R      GP A+++APTRELAQQI++    FG    +
Sbjct: 260 GSGKTLAFLIPLLSWIQSLPKIERLEDVDQGPYAIIMAPTRELAQQIEEETTKFGQPLGI 319

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   V GG  + EQ   L  G EIVIAT
Sbjct: 320 RTVVVVGGLSREEQGFRLRLGCEIVIAT 347



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 45/105 (42%), Positives = 60/105 (57%), Gaps = 25/105 (23%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD-------- 397
           GRLID LE     L +CTY+VLDEADRM+DMGFEP ++KI+E      ++PD        
Sbjct: 349 GRLIDVLENRYLVLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDET 408

Query: 398 ------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
                       RQT+M++AT P  V++LA  YL     + IGS+
Sbjct: 409 KLMENFYTKKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSV 453


>AE014134-2947|AAF53680.2|  822|Drosophila melanogaster CG10333-PA
           protein.
          Length = 822

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 41/88 (46%), Positives = 53/88 (60%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR----GDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKTLA+++P +  I + P I R      GP A+++APTRELAQQI++    FG    +
Sbjct: 441 GSGKTLAFLIPLLSWIQSLPKIERLEDVDQGPYAIIMAPTRELAQQIEEETTKFGQPLGI 500

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   V GG  + EQ   L  G EIVIAT
Sbjct: 501 RTVVVVGGLSREEQGFRLRLGCEIVIAT 528



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 45/105 (42%), Positives = 60/105 (57%), Gaps = 25/105 (23%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD-------- 397
           GRLID LE     L +CTY+VLDEADRM+DMGFEP ++KI+E      ++PD        
Sbjct: 530 GRLIDVLENRYLVLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDET 589

Query: 398 ------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
                       RQT+M++AT P  V++LA  YL     + IGS+
Sbjct: 590 KLMENFYTKKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSV 634


>AE014298-914|AAF46176.1|  438|Drosophila melanogaster CG14443-PA
           protein.
          Length = 438

 Score = 74.9 bits (176), Expect = 9e-14
 Identities = 32/83 (38%), Positives = 53/83 (63%), Gaps = 2/83 (2%)
 Frame = +2

Query: 254 SGRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           +GRL+  ++  K    L+RCTYLVLD  DRM+D+G E  I +++ ++RP  Q ++ S +W
Sbjct: 159 AGRLLQMIDNKKHVVELERCTYLVLDNIDRMIDVGLEGNICRLLCRLRPHAQLIVSSTSW 218

Query: 428 PKEVKKLAEDYLGDYIQINIGSL 496
              +K++A  +LG Y  I +G +
Sbjct: 219 SSNLKRMANKFLGQYTAIRVGEI 241



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 1/66 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-RRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL Y+LP I+ ++NQ  + +   GPI L+L   RE A  +Q+    + +   +R  
Sbjct: 79  GTGKTLGYLLPGIMKMHNQRGLMQHKKGPIVLILVDCREAAVMVQREVLYYTNPLELRTH 138

Query: 180 CVFGGA 197
           C+ G +
Sbjct: 139 CLLGNS 144


>AY121677-1|AAM52004.1|  507|Drosophila melanogaster RE27528p
           protein.
          Length = 507

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRL+D LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++ +  +R+T ++SAT  
Sbjct: 188 GRLVDHLENMKGF-NLKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMT 246

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+VKKL    L D +++ + +
Sbjct: 247 KKVKKLQRASLKDPVKVEVSN 267



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 34/84 (40%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I+H   + P R      ALVL PTRELA QI +     G    ++   
Sbjct: 108 GSGKTGAFALP-ILHALLENPQRY----FALVLTPTRELAFQIGEQFEALGSGIGIKCCV 162

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG     Q   L +   I+IAT
Sbjct: 163 VVGGMDMVAQGLQLAKKPHIIIAT 186


>AE014134-3342|AAF53963.1|  507|Drosophila melanogaster CG9253-PA
           protein.
          Length = 507

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRL+D LE  KG  NL+   YLV+DEADR+L+M FE ++ KI++ +  +R+T ++SAT  
Sbjct: 188 GRLVDHLENMKGF-NLKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMT 246

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           K+VKKL    L D +++ + +
Sbjct: 247 KKVKKLQRASLKDPVKVEVSN 267



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 34/84 (40%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I+H   + P R      ALVL PTRELA QI +     G    ++   
Sbjct: 108 GSGKTGAFALP-ILHALLENPQRY----FALVLTPTRELAFQIGEQFEALGSGIGIKCCV 162

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG     Q   L +   I+IAT
Sbjct: 163 VVGGMDMVAQGLQLAKKPHIIIAT 186


>M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase
           protein.
          Length = 459

 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 31/90 (34%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D ++K   ++  C  LVLDEAD++L + F+  +  +I ++  D Q L++SAT+P  
Sbjct: 185 GRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLT 244

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   E +L +  +IN+   L L  +T ++
Sbjct: 245 VKNFMEKHLREPYEINLMEELTLKGVTQYY 274



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 28/84 (33%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY +P +  I+   P +  D   ALV+ PTRELA Q  Q+  +      +R   
Sbjct: 105 GTGKTGAYCIPVLEQID---PTK--DYIQALVMVPTRELALQTSQICIELAKHLDIRVMV 159

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    + + V+++IAT
Sbjct: 160 TTGGTILKDDILRIYQKVQLIIAT 183


>AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p
           protein.
          Length = 459

 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 31/90 (34%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D ++K   ++  C  LVLDEAD++L + F+  +  +I ++  D Q L++SAT+P  
Sbjct: 185 GRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLT 244

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   E +L +  +IN+   L L  +T ++
Sbjct: 245 VKNFMEKHLREPYEINLMEELTLKGVTQYY 274



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 28/84 (33%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY +P +  I+   P +  D   ALV+ PTRELA Q  Q+  +      +R   
Sbjct: 105 GTGKTGAYCIPVLEQID---PTK--DYIQALVMVPTRELALQTSQICIELAKHLDIRVMV 159

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    + + V+++IAT
Sbjct: 160 TTGGTILKDDILRIYQKVQLIIAT 183


>AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB,
           isoform B protein.
          Length = 428

 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 31/90 (34%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D ++K   ++  C  LVLDEAD++L + F+  +  +I ++  D Q L++SAT+P  
Sbjct: 154 GRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLT 213

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   E +L +  +IN+   L L  +T ++
Sbjct: 214 VKNFMEKHLREPYEINLMEELTLKGVTQYY 243



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 28/84 (33%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY +P +  I+   P +  D   ALV+ PTRELA Q  Q+  +      +R   
Sbjct: 74  GTGKTGAYCIPVLEQID---PTK--DYIQALVMVPTRELALQTSQICIELAKHLDIRVMV 128

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    + + V+++IAT
Sbjct: 129 TTGGTILKDDILRIYQKVQLIIAT 152


>AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA,
           isoform A protein.
          Length = 459

 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 31/90 (34%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D ++K   ++  C  LVLDEAD++L + F+  +  +I ++  D Q L++SAT+P  
Sbjct: 185 GRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLT 244

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   E +L +  +IN+   L L  +T ++
Sbjct: 245 VKNFMEKHLREPYEINLMEELTLKGVTQYY 274



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 28/84 (33%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY +P +  I+   P +  D   ALV+ PTRELA Q  Q+  +      +R   
Sbjct: 105 GTGKTGAYCIPVLEQID---PTK--DYIQALVMVPTRELALQTSQICIELAKHLDIRVMV 159

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    + + V+++IAT
Sbjct: 160 TTGGTILKDDILRIYQKVQLIIAT 183


>AY119628-1|AAM50282.1|  826|Drosophila melanogaster RE19835p
           protein.
          Length = 826

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 35/82 (42%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++    N      LVLDEADR LDMGF+  +  IIE   P RQTL++SAT
Sbjct: 199 CTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSAT 258

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
               V+ LA   L D + +  G
Sbjct: 259 QTNTVQDLARLNLKDPVYVGYG 280



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVRNT 179
           GSGKTLA+++P + H+       R DG  A++++PTRELA QI +     G H  +    
Sbjct: 119 GSGKTLAFLIPVLEHLFMNK-WSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGL 177

Query: 180 CVFGGAPKREQAR 218
            + G   K E+ R
Sbjct: 178 IIGGKNLKFERTR 190


>AE014298-2591|AAF48747.2|  826|Drosophila melanogaster CG5800-PA
           protein.
          Length = 826

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 35/82 (42%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++    N      LVLDEADR LDMGF+  +  IIE   P RQTL++SAT
Sbjct: 199 CTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSAT 258

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
               V+ LA   L D + +  G
Sbjct: 259 QTNTVQDLARLNLKDPVYVGYG 280



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVRNT 179
           GSGKTLA+++P + H+       R DG  A++++PTRELA QI +     G H  +    
Sbjct: 119 GSGKTLAFLIPVLEHLFMNK-WSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGL 177

Query: 180 CVFGGAPKREQAR 218
            + G   K E+ R
Sbjct: 178 IIGGKNLKFERTR 190


>AF145609-1|AAD38584.1|  974|Drosophila melanogaster BcDNA.GH02833
           protein.
          Length = 974

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-IRRGDGPIALVLAPTRELAQQIQQVAADF--GHTSYVR 173
           GSGKTLAY LP +  +  Q P I+R DG +ALV+ PTREL  Q  ++       +T  V 
Sbjct: 374 GSGKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPTRELVMQTYELIQKLVKPYTWIVP 433

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
            + + G + K E+AR L +G+ I+I T
Sbjct: 434 GSLLGGESRKSEKAR-LRKGINILIGT 459



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 12/77 (15%)
 Frame = +2

Query: 257 GRLID-FLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-----------RPDR 400
           GRL+D  L   +  L +  +L+LDEADR+L++G+E  +++++E I            P  
Sbjct: 461 GRLVDHLLHTASFKLTKLQFLILDEADRLLELGYERDVKQLVEAIDKQRAECEDKELPQL 520

Query: 401 QTLMWSATWPKEVKKLA 451
           Q ++ SAT   +V++LA
Sbjct: 521 QRMLLSATLTSQVQQLA 537


>AE014298-2568|AAO41693.1|  975|Drosophila melanogaster CG8611-PB,
           isoform B protein.
          Length = 975

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-IRRGDGPIALVLAPTRELAQQIQQVAADF--GHTSYVR 173
           GSGKTLAY LP +  +  Q P I+R DG +ALV+ PTREL  Q  ++       +T  V 
Sbjct: 375 GSGKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPTRELVMQTYELIQKLVKPYTWIVP 434

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
            + + G + K E+AR L +G+ I+I T
Sbjct: 435 GSLLGGESRKSEKAR-LRKGINILIGT 460



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 12/77 (15%)
 Frame = +2

Query: 257 GRLID-FLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-----------RPDR 400
           GRL+D  L   +  L +  +L+LDEADR+L++G+E  +++++E I            P  
Sbjct: 462 GRLVDHLLHTASFKLTKLQFLILDEADRLLELGYERDVKQLVEAIDKQRAECEDKELPQL 521

Query: 401 QTLMWSATWPKEVKKLA 451
           Q ++ SAT   +V++LA
Sbjct: 522 QRMLLSATLTSQVQQLA 538


>AE014298-2567|AAF48727.2|  974|Drosophila melanogaster CG8611-PA,
           isoform A protein.
          Length = 974

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-IRRGDGPIALVLAPTRELAQQIQQVAADF--GHTSYVR 173
           GSGKTLAY LP +  +  Q P I+R DG +ALV+ PTREL  Q  ++       +T  V 
Sbjct: 374 GSGKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPTRELVMQTYELIQKLVKPYTWIVP 433

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
            + + G + K E+AR L +G+ I+I T
Sbjct: 434 GSLLGGESRKSEKAR-LRKGINILIGT 459



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 12/77 (15%)
 Frame = +2

Query: 257 GRLID-FLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-----------RPDR 400
           GRL+D  L   +  L +  +L+LDEADR+L++G+E  +++++E I            P  
Sbjct: 461 GRLVDHLLHTASFKLTKLQFLILDEADRLLELGYERDVKQLVEAIDKQRAECEDKELPQL 520

Query: 401 QTLMWSATWPKEVKKLA 451
           Q ++ SAT   +V++LA
Sbjct: 521 QRMLLSATLTSQVQQLA 537


>AY121623-1|AAM51950.1|  403|Drosophila melanogaster GH17619p
           protein.
          Length = 403

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     Q     VLDEAD ML  GF+ QI+ + + + PD Q ++ SAT P +
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 216

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V +++  ++ D + I +    L L  I  F+
Sbjct: 217 VLEVSRCFMRDPVSILVKKEELTLEGIKQFY 247



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    IR      AL+LAPTRELA QIQ+V    G    V +  
Sbjct: 77  GTGKTATFSIAILQQIDTS--IRECQ---ALILAPTRELATQIQRVVMALGEYMKVHSHA 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   RE AR LE G  +V+ T
Sbjct: 132 CIGGTNVREDARILESGCHVVVGT 155


>AY089635-1|AAL90373.1|  399|Drosophila melanogaster RE50350p
           protein.
          Length = 399

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 36/118 (30%), Positives = 56/118 (47%), Gaps = 2/118 (1%)
 Frame = +2

Query: 176 HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGF 355
           HVC+   +       L  G        GR+ D +++     +    LVLDEAD ML+ GF
Sbjct: 126 HVCIGGTNLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGF 185

Query: 356 EPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + QI  +   + P  Q ++ SAT P E+ ++   ++ D I+I +    L L  I  FF
Sbjct: 186 KEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFF 243



 Score = 37.9 bits (84), Expect = 0.013
 Identities = 28/84 (33%), Positives = 39/84 (46%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++    +R       L L+PTRELA QIQ+V    G    V+   
Sbjct: 73  GTGKTATFSISILQSLDTT--LRETQ---VLCLSPTRELAVQIQKVILALGDMMNVQCHV 127

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  IV  T
Sbjct: 128 CIGGTNLGEDIRKLDYGQHIVSGT 151


>AY069283-1|AAL39428.1|  403|Drosophila melanogaster GM14109p
           protein.
          Length = 403

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     Q     VLDEAD ML  GF+ QI+ + + + PD Q ++ SAT P +
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 216

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V +++  ++ D + I +    L L  I  F+
Sbjct: 217 VLEVSRCFMRDPVSILVKKEELTLEGIKQFY 247



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    IR      AL+LAPTRELA QIQ+V    G    V +  
Sbjct: 77  GTGKTATFSIAILQQIDTS--IRECQ---ALILAPTRELATQIQRVVMALGEYMKVHSHA 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   RE AR LE G  +V+ T
Sbjct: 132 CIGGTNVREDARILESGCHVVVGT 155


>AF145621-1|AAD38596.1|  403|Drosophila melanogaster eukaryotic
           initiation factor-4a protein.
          Length = 403

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     Q     VLDEAD ML  GF+ QI+ + + + PD Q ++ SAT P +
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 216

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V +++  ++ D + I +    L L  I  F+
Sbjct: 217 VLEVSRCFMRDPVSILVKKEELTLEGIKQFY 247



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    IR      AL+LAPTRELA QIQ+V    G    V +  
Sbjct: 77  GTGKTATFSIAILQQIDTS--IRECQ---ALILAPTRELATQIQRVVMALGEYMKVHSHA 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   RE AR LE G  +V+ T
Sbjct: 132 CIGGTNVREDARILESGCHVVVGT 155


>AE014297-735|AAF54221.1|  399|Drosophila melanogaster CG7483-PA
           protein.
          Length = 399

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 36/118 (30%), Positives = 56/118 (47%), Gaps = 2/118 (1%)
 Frame = +2

Query: 176 HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGF 355
           HVC+   +       L  G        GR+ D +++     +    LVLDEAD ML+ GF
Sbjct: 126 HVCIGGTNLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGF 185

Query: 356 EPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + QI  +   + P  Q ++ SAT P E+ ++   ++ D I+I +    L L  I  FF
Sbjct: 186 KEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFF 243



 Score = 37.9 bits (84), Expect = 0.013
 Identities = 28/84 (33%), Positives = 39/84 (46%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  ++    +R       L L+PTRELA QIQ+V    G    V+   
Sbjct: 73  GTGKTATFSISILQSLDTT--LRETQ---VLCLSPTRELAVQIQKVILALGDMMNVQCHV 127

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  IV  T
Sbjct: 128 CIGGTNLGEDIRKLDYGQHIVSGT 151


>AE014134-1011|AAN10568.1|  403|Drosophila melanogaster CG9075-PD,
           isoform D protein.
          Length = 403

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     Q     VLDEAD ML  GF+ QI+ + + + PD Q ++ SAT P +
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 216

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V +++  ++ D + I +    L L  I  F+
Sbjct: 217 VLEVSRCFMRDPVSILVKKEELTLEGIKQFY 247



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    IR      AL+LAPTRELA QIQ+V    G    V +  
Sbjct: 77  GTGKTATFSIAILQQIDTS--IRECQ---ALILAPTRELATQIQRVVMALGEYMKVHSHA 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   RE AR LE G  +V+ T
Sbjct: 132 CIGGTNVREDARILESGCHVVVGT 155


>AE014134-1010|AAN10567.1|  403|Drosophila melanogaster CG9075-PB,
           isoform B protein.
          Length = 403

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     Q     VLDEAD ML  GF+ QI+ + + + PD Q ++ SAT P +
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 216

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V +++  ++ D + I +    L L  I  F+
Sbjct: 217 VLEVSRCFMRDPVSILVKKEELTLEGIKQFY 247



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    IR      AL+LAPTRELA QIQ+V    G    V +  
Sbjct: 77  GTGKTATFSIAILQQIDTS--IRECQ---ALILAPTRELATQIQRVVMALGEYMKVHSHA 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   RE AR LE G  +V+ T
Sbjct: 132 CIGGTNVREDARILESGCHVVVGT 155


>AE014134-1009|AAN10566.1|  403|Drosophila melanogaster CG9075-PC,
           isoform C protein.
          Length = 403

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     Q     VLDEAD ML  GF+ QI+ + + + PD Q ++ SAT P +
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 216

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V +++  ++ D + I +    L L  I  F+
Sbjct: 217 VLEVSRCFMRDPVSILVKKEELTLEGIKQFY 247



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    IR      AL+LAPTRELA QIQ+V    G    V +  
Sbjct: 77  GTGKTATFSIAILQQIDTS--IRECQ---ALILAPTRELATQIQRVVMALGEYMKVHSHA 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   RE AR LE G  +V+ T
Sbjct: 132 CIGGTNVREDARILESGCHVVVGT 155


>AE014134-1008|AAF52317.2|  403|Drosophila melanogaster CG9075-PA,
           isoform A protein.
          Length = 403

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     Q     VLDEAD ML  GF+ QI+ + + + PD Q ++ SAT P +
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 216

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V +++  ++ D + I +    L L  I  F+
Sbjct: 217 VLEVSRCFMRDPVSILVKKEELTLEGIKQFY 247



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    IR      AL+LAPTRELA QIQ+V    G    V +  
Sbjct: 77  GTGKTATFSIAILQQIDTS--IRECQ---ALILAPTRELATQIQRVVMALGEYMKVHSHA 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   RE AR LE G  +V+ T
Sbjct: 132 CIGGTNVREDARILESGCHVVVGT 155


>BT004908-1|AAO49161.1|  782|Drosophila melanogaster LD15481p
           protein.
          Length = 782

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID ++   +  L     L+LDEADRMLD  F  Q+++II      RQT+++SAT  +
Sbjct: 288 GRLIDHIKNTPSFTLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSE 347

Query: 434 EVKKLAEDYLGDYIQINIGSLQ 499
           +VK LA   L   I++ + + Q
Sbjct: 348 QVKDLAAVSLDKPIKVFVNNNQ 369



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 29/84 (34%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY+LP +  +  +P   +    + LVL PTREL  Q+ QV       + +    
Sbjct: 204 GTGKTAAYMLPTLERLLYRPLNNKAITRV-LVLVPTRELGAQVYQVTKQLCQFTTIDVGL 262

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L +  +IVIAT
Sbjct: 263 AIGGLDVKAQEAVLRQNPDIVIAT 286


>AF181659-1|AAD55444.1|  641|Drosophila melanogaster BcDNA.GM05306
           protein.
          Length = 641

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID ++   +  L     L+LDEADRMLD  F  Q+++II      RQT+++SAT  +
Sbjct: 288 GRLIDHIKNTPSFTLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSE 347

Query: 434 EVKKLAEDYLGDYIQINIGSLQ 499
           +VK LA   L   I++ + + Q
Sbjct: 348 QVKDLAAVSLDKPIKVFVNNNQ 369



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 29/84 (34%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY+LP +  +  +P   +    + LVL PTREL  Q+ QV       + +    
Sbjct: 204 GTGKTAAYMLPTLERLLYRPLNNKAITRV-LVLVPTRELGAQVYQVTKQLCQFTTIDVGL 262

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L +  +IVIAT
Sbjct: 263 AIGGLDVKAQEAVLRQNPDIVIAT 286


>AE013599-611|AAF59119.1|  782|Drosophila melanogaster CG2173-PA
           protein.
          Length = 782

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRLID ++   +  L     L+LDEADRMLD  F  Q+++II      RQT+++SAT  +
Sbjct: 288 GRLIDHIKNTPSFTLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSE 347

Query: 434 EVKKLAEDYLGDYIQINIGSLQ 499
           +VK LA   L   I++ + + Q
Sbjct: 348 QVKDLAAVSLDKPIKVFVNNNQ 369



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 29/84 (34%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY+LP +  +  +P   +    + LVL PTREL  Q+ QV       + +    
Sbjct: 204 GTGKTAAYMLPTLERLLYRPLNNKAITRV-LVLVPTRELGAQVYQVTKQLCQFTTIDVGL 262

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q   L +  +IVIAT
Sbjct: 263 AIGGLDVKAQEAVLRQNPDIVIAT 286


>AY075397-1|AAL68229.1|  827|Drosophila melanogaster LD28101p
           protein.
          Length = 827

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 27/77 (35%), Positives = 43/77 (55%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR +    +    L    Y+V DEADR+ +MGF  Q+ + + ++   RQT+M+SAT PK 
Sbjct: 168 GRFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKL 227

Query: 437 VKKLAEDYLGDYIQINI 487
           + + A   L D + I +
Sbjct: 228 LVEFARAGLNDPVLIRL 244



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT  +++P    +  + P +   G  AL+L+PTRELA Q  +   + G    +++  
Sbjct: 86  GSGKTACFLIPLFEKLQRREPTK---GARALILSPTRELAVQTYKFIKELGRFMELKSIL 142

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG     Q   +    ++++AT
Sbjct: 143 VLGGDSMDSQFSAIHTCPDVIVAT 166


>AE014296-83|AAN11439.1|  827|Drosophila melanogaster CG32344-PA
           protein.
          Length = 827

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 27/77 (35%), Positives = 43/77 (55%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR +    +    L    Y+V DEADR+ +MGF  Q+ + + ++   RQT+M+SAT PK 
Sbjct: 168 GRFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKL 227

Query: 437 VKKLAEDYLGDYIQINI 487
           + + A   L D + I +
Sbjct: 228 LVEFARAGLNDPVLIRL 244



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT  +++P    +  + P +   G  AL+L+PTRELA Q  +   + G    +++  
Sbjct: 86  GSGKTACFLIPLFEKLQRREPTK---GARALILSPTRELAVQTYKFIKELGRFMELKSIL 142

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG     Q   +    ++++AT
Sbjct: 143 VLGGDSMDSQFSAIHTCPDVIVAT 166


>X69045-1|CAA48790.1|  402|Drosophila melanogaster eukaryotic
           translation initiationfactor 4A (eIF-4A) protein.
          Length = 402

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    IR      AL+LAPTRELA QIQ+V    G    V +  
Sbjct: 77  GTGKTATFSIAILQQIDTS--IRECQ---ALILAPTRELATQIQRVVMALGEYMKVHSHA 131

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   RE AR LE G  +V+ T
Sbjct: 132 CIGGTNVREDARILESGCHVVVGT 155



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     Q     VLDEAD ML  GF+ QI+ + + + PD Q ++ SAT P +
Sbjct: 157 GRVYDMINR-KLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 215

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V +++  ++ D + I +    L L  I  F+
Sbjct: 216 VLEVSRCFMRDPVSILVKKEELTLEGIKQFY 246


>U84552-1|AAC27683.1|  663|Drosophila melanogaster helicase
           pitchoune protein.
          Length = 663

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           S  LG+G        GRL+D L+     L +    L++DE DR+L++GFE ++++II  +
Sbjct: 286 SEKLGKGINILVATPGRLLDHLQNSPDFLYKNLQCLIIDEVDRILEIGFEEELKQIINLL 345

Query: 389 RPDRQTLMWSATWPKEVKKLAE 454
              RQT+++SAT    ++ L++
Sbjct: 346 PKRRQTMLFSATQTARIEALSK 367



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 28/84 (33%), Positives = 50/84 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++PA+  IN    + R +G   ++++PTREL+ Q   V  +     +     
Sbjct: 217 GSGKTLAFLIPAVELINKLRFMPR-NGTGVIIISPTRELSMQTFGVLKELMAHHHHTYGL 275

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG+ ++ ++  L +G+ I++AT
Sbjct: 276 VMGGSNRQVESEKLGKGINILVAT 299


>AY119620-1|AAM50274.1|  680|Drosophila melanogaster LD46167p
           protein.
          Length = 680

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           S  LG+G        GRL+D L+     L +    L++DE DR+L++GFE ++++II  +
Sbjct: 303 SEKLGKGINILVATPGRLLDHLQNSPDFLYKNLQCLIIDEVDRILEIGFEEELKQIINLL 362

Query: 389 RPDRQTLMWSATWPKEVKKLAE 454
              RQT+++SAT    ++ L++
Sbjct: 363 PKRRQTMLFSATQTARIEALSK 384



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 28/84 (33%), Positives = 50/84 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++PA+  IN    + R +G   ++++PTREL+ Q   V  +     +     
Sbjct: 234 GSGKTLAFLIPAVELINKLRFMPR-NGTGVIIISPTRELSMQTFGVLKELMAHHHHTYGL 292

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG+ ++ ++  L +G+ I++AT
Sbjct: 293 VMGGSNRQVESEKLGKGINILVAT 316


>AY071402-1|AAL49024.1|  680|Drosophila melanogaster RE48840p
           protein.
          Length = 680

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           S  LG+G        GRL+D L+     L +    L++DE DR+L++GFE ++++II  +
Sbjct: 303 SEKLGKGINILVATPGRLLDHLQNSPDFLYKNLQCLIIDEVDRILEIGFEEELKQIINLL 362

Query: 389 RPDRQTLMWSATWPKEVKKLAE 454
              RQT+++SAT    ++ L++
Sbjct: 363 PKRRQTMLFSATQTARIEALSK 384



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 28/84 (33%), Positives = 50/84 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++PA+  IN    + R +G   ++++PTREL+ Q   V  +     +     
Sbjct: 234 GSGKTLAFLIPAVELINKLRFMPR-NGTGVIIISPTRELSMQTFGVLKELMAHHHHTYGL 292

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG+ ++ ++  L +G+ I++AT
Sbjct: 293 VMGGSNRQVESEKLGKGINILVAT 316


>AE014297-3091|AAN13900.2|  680|Drosophila melanogaster CG6375-PB,
           isoform B protein.
          Length = 680

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           S  LG+G        GRL+D L+     L +    L++DE DR+L++GFE ++++II  +
Sbjct: 303 SEKLGKGINILVATPGRLLDHLQNSPDFLYKNLQCLIIDEVDRILEIGFEEELKQIINLL 362

Query: 389 RPDRQTLMWSATWPKEVKKLAE 454
              RQT+++SAT    ++ L++
Sbjct: 363 PKRRQTMLFSATQTARIEALSK 384



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 28/84 (33%), Positives = 50/84 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++PA+  IN    + R +G   ++++PTREL+ Q   V  +     +     
Sbjct: 234 GSGKTLAFLIPAVELINKLRFMPR-NGTGVIIISPTRELSMQTFGVLKELMAHHHHTYGL 292

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG+ ++ ++  L +G+ I++AT
Sbjct: 293 VMGGSNRQVESEKLGKGINILVAT 316


>AE014297-3090|AAF55951.2|  680|Drosophila melanogaster CG6375-PA,
           isoform A protein.
          Length = 680

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           S  LG+G        GRL+D L+     L +    L++DE DR+L++GFE ++++II  +
Sbjct: 303 SEKLGKGINILVATPGRLLDHLQNSPDFLYKNLQCLIIDEVDRILEIGFEEELKQIINLL 362

Query: 389 RPDRQTLMWSATWPKEVKKLAE 454
              RQT+++SAT    ++ L++
Sbjct: 363 PKRRQTMLFSATQTARIEALSK 384



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 28/84 (33%), Positives = 50/84 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++PA+  IN    + R +G   ++++PTREL+ Q   V  +     +     
Sbjct: 234 GSGKTLAFLIPAVELINKLRFMPR-NGTGVIIISPTRELSMQTFGVLKELMAHHHHTYGL 292

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG+ ++ ++  L +G+ I++AT
Sbjct: 293 VMGGSNRQVESEKLGKGINILVAT 316


>AY051513-1|AAK92937.1|  613|Drosophila melanogaster GH16590p
           protein.
          Length = 613

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 6/86 (6%)
 Frame = +2

Query: 248 CYSGRLID-FLEKG-----TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTL 409
           C  GRL D F  KG        ++   +LVLDEADR+LD+GF+  +  I+  +   R+T 
Sbjct: 142 CTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTG 201

Query: 410 MWSATWPKEVKKLAEDYLGDYIQINI 487
           ++SAT   EV  L    L + + +++
Sbjct: 202 LFSATQTTEVTDLIRAGLRNPVLVSV 227



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 5/87 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ-PPIRRGDGPI-ALVLAPTRELAQQIQQVAADF---GHTSY 167
           GSGKTLA+++P +  +  +      G   I ALV++PTRELA+QI +V A F       +
Sbjct: 54  GSGKTLAFLVPMLEILQRRHKETPWGPKEIGALVISPTRELARQISEVLAQFLEHEDLEH 113

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVI 248
           +    + GG    E    L R    ++
Sbjct: 114 LNQQLIVGGNSIEEDIATLRRETPCIL 140


>AE014297-721|AAF54208.1|  613|Drosophila melanogaster CG9630-PA
           protein.
          Length = 613

 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 6/86 (6%)
 Frame = +2

Query: 248 CYSGRLID-FLEKG-----TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTL 409
           C  GRL D F  KG        ++   +LVLDEADR+LD+GF+  +  I+  +   R+T 
Sbjct: 142 CTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTG 201

Query: 410 MWSATWPKEVKKLAEDYLGDYIQINI 487
           ++SAT   EV  L    L + + +++
Sbjct: 202 LFSATQTTEVTDLIRAGLRNPVLVSV 227



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 5/87 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ-PPIRRGDGPI-ALVLAPTRELAQQIQQVAADF---GHTSY 167
           GSGKTLA+++P +  +  +      G   I ALV++PTRELA+QI +V A F       +
Sbjct: 54  GSGKTLAFLVPMLEILQRRHKETPWGPKEIGALVISPTRELARQISEVLAQFLEHEDLEH 113

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVI 248
           +    + GG    E    L R    ++
Sbjct: 114 LNQQLIVGGNSIEEDIATLRRETPCIL 140


>Z23266-1|CAA80804.1|  527|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 527

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 30/83 (36%), Positives = 42/83 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  ++ +P         ALVL PT ELA QI +     G    VR   
Sbjct: 54  GSGKTFAFALPILERLSEEPVSH-----FALVLTPTHELAYQISEQFLVAGQAMGVRVCV 108

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
           V GG  +  +++ L +   IV+A
Sbjct: 109 VSGGTDQMVESQKLMQRPHIVVA 131



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP-DRQTLMWSATWP 430
           GRL D L    T +     YLV+DEAD ML+  F+  +  IIE+  P  RQ L +SAT  
Sbjct: 134 GRLADHLTGCDTFSFDNLKYLVVDEADPMLNGDFDESL-SIIERCLPKTRQNLFFSATMK 192

Query: 431 KEVKK 445
             +K+
Sbjct: 193 DFIKE 197


>L13612-1|AAA16339.1|  527|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 527

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 30/83 (36%), Positives = 42/83 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  ++ +P         ALVL PT ELA QI +     G    VR   
Sbjct: 54  GSGKTFAFALPILERLSEEPVSH-----FALVLTPTHELAYQISEQFLVAGQAMGVRVCV 108

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
           V GG  +  +++ L +   IV+A
Sbjct: 109 VSGGTDQMVESQKLMQRPHIVVA 131



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP-DRQTLMWSATWP 430
           GRL D L    T +     YLV+DEAD ML+  F+  +  IIE+  P  RQ L +SAT  
Sbjct: 134 GRLADHLTGCDTFSFDNLKYLVVDEADPMLNGDFDESL-SIIERCLPKTRQNLFFSATMK 192

Query: 431 KEVKK 445
             +K+
Sbjct: 193 DFIKE 197


>AY058728-1|AAL13957.1|  521|Drosophila melanogaster LD47509p
           protein.
          Length = 521

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 30/83 (36%), Positives = 42/83 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  ++ +P         ALVL PT ELA QI +     G    VR   
Sbjct: 54  GSGKTFAFALPILERLSEEPVSH-----FALVLTPTHELAYQISEQFLVAGQAMGVRVCV 108

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
           V GG  +  +++ L +   IV+A
Sbjct: 109 VSGGTDQMVESQKLMQRPHIVVA 131



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 28/65 (43%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP-DRQTLMWSATWP 430
           GRL D L    T +     YLV+DEADRML+  F+  +  IIE+  P  RQ L +SAT  
Sbjct: 134 GRLADHLTGCDTFSFDNLKYLVVDEADRMLNGDFDESL-SIIERCLPKTRQNLFFSATMK 192

Query: 431 KEVKK 445
             +K+
Sbjct: 193 DFIKE 197


>AE013599-778|AAF58994.1|  521|Drosophila melanogaster CG12759-PA
           protein.
          Length = 521

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 30/83 (36%), Positives = 42/83 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  ++ +P         ALVL PT ELA QI +     G    VR   
Sbjct: 54  GSGKTFAFALPILERLSEEPVSH-----FALVLTPTHELAYQISEQFLVAGQAMGVRVCV 108

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
           V GG  +  +++ L +   IV+A
Sbjct: 109 VSGGTDQMVESQKLMQRPHIVVA 131



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 28/65 (43%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP-DRQTLMWSATWP 430
           GRL D L    T +     YLV+DEADRML+  F+  +  IIE+  P  RQ L +SAT  
Sbjct: 134 GRLADHLTGCDTFSFDNLKYLVVDEADRMLNGDFDESL-SIIERCLPKTRQNLFFSATMK 192

Query: 431 KEVKK 445
             +K+
Sbjct: 193 DFIKE 197


>AE014296-2963|AAF49303.1|  594|Drosophila melanogaster CG5589-PA
           protein.
          Length = 594

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++ P I    N     +  G  ALVLAPTRELAQQI +  A+    + +R   
Sbjct: 166 GSGKTLAFLTPII----NGLRAHKTTGLRALVLAPTRELAQQIYRECAELTRETGLRTHF 221

Query: 183 VFG-GAPKREQARDLERGVEIVIAT 254
           +      K++   + ++  +I+++T
Sbjct: 222 ISKVSEAKQKHGAECKQRYDILVST 246



 Score = 36.7 bits (81), Expect = 0.029
 Identities = 29/87 (33%), Positives = 46/87 (52%), Gaps = 4/87 (4%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMG---FEPQIRKIIEQI-RPDRQTLMWSATWPKEVKKLAEDY 460
           +L    + VLDEADR+++ G   F+ Q+  I      P +    +SAT+   V K A  +
Sbjct: 262 DLSHVEWFVLDEADRLMEEGQNNFKEQLDDIYAACSNPTKCVAFFSATYTVPVAKWALRH 321

Query: 461 LGDYIQINIGSLQLSAITTFFKL*IFV 541
           L + ++I IG +Q SA  T  +  +FV
Sbjct: 322 LKNLVRITIG-VQNSATETVQQELLFV 347


>X79802-1|CAA56197.1|  424|Drosophila melanogaster WM6 protein.
          Length = 424

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/78 (24%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +     NL+   + VLDE D+ML+ +     +++I       +Q +M+SAT  K
Sbjct: 171 GRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSK 230

Query: 434 EVKKLAEDYLGDYIQINI 487
           +++ + + ++ D +++ +
Sbjct: 231 DIRPVCKKFMQDPMEVYV 248


>L06018-1|AAB65835.1|  424|Drosophila melanogaster DECD family
           putative RNA helicase protein.
          Length = 424

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/78 (24%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +     NL+   + VLDE D+ML+ +     +++I       +Q +M+SAT  K
Sbjct: 171 GRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSK 230

Query: 434 EVKKLAEDYLGDYIQINI 487
           +++ + + ++ D +++ +
Sbjct: 231 DIRPVCKKFMQDPMEVYV 248


>AY118921-1|AAM50781.1|  424|Drosophila melanogaster LD23644p
           protein.
          Length = 424

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/78 (24%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +     NL+   + VLDE D+ML+ +     +++I       +Q +M+SAT  K
Sbjct: 171 GRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSK 230

Query: 434 EVKKLAEDYLGDYIQINI 487
           +++ + + ++ D +++ +
Sbjct: 231 DIRPVCKKFMQDPMEVYV 248


>AE014134-934|AAN10545.1|  424|Drosophila melanogaster CG7269-PC,
           isoform C protein.
          Length = 424

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/78 (24%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +     NL+   + VLDE D+ML+ +     +++I       +Q +M+SAT  K
Sbjct: 171 GRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSK 230

Query: 434 EVKKLAEDYLGDYIQINI 487
           +++ + + ++ D +++ +
Sbjct: 231 DIRPVCKKFMQDPMEVYV 248


>AE014134-933|AAN10544.1|  424|Drosophila melanogaster CG7269-PB,
           isoform B protein.
          Length = 424

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/78 (24%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +     NL+   + VLDE D+ML+ +     +++I       +Q +M+SAT  K
Sbjct: 171 GRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSK 230

Query: 434 EVKKLAEDYLGDYIQINI 487
           +++ + + ++ D +++ +
Sbjct: 231 DIRPVCKKFMQDPMEVYV 248


>AE014134-932|AAF52261.1|  424|Drosophila melanogaster CG7269-PA,
           isoform A protein.
          Length = 424

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/78 (24%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++  +     NL+   + VLDE D+ML+ +     +++I       +Q +M+SAT  K
Sbjct: 171 GRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSK 230

Query: 434 EVKKLAEDYLGDYIQINI 487
           +++ + + ++ D +++ +
Sbjct: 231 DIRPVCKKFMQDPMEVYV 248


>AY058512-1|AAL13741.1|  536|Drosophila melanogaster LD21669p
           protein.
          Length = 536

 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI--RRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           G GKT+ Y+LP +  +  +  +  R+ + P  L+L P RELA QI  V       + ++ 
Sbjct: 156 GCGKTITYLLPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKV 215

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  K+         V+I++AT
Sbjct: 216 QSLLGGNTKQLMMNPQFEEVDILVAT 241


>AE014134-152|AAF51458.1|  536|Drosophila melanogaster CG3561-PA
           protein.
          Length = 536

 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI--RRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           G GKT+ Y+LP +  +  +  +  R+ + P  L+L P RELA QI  V       + ++ 
Sbjct: 156 GCGKTITYLLPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKV 215

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG  K+         V+I++AT
Sbjct: 216 QSLLGGNTKQLMMNPQFEEVDILVAT 241


>AY119661-1|AAM50315.1|  727|Drosophila melanogaster SD05527p
           protein.
          Length = 727

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 7/73 (9%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE---PQIRKIIEQIRPD---RQTLMWS 418
           GRL + +  G   L  C + VLDEAD +L  G+     ++ K I +I  D    Q ++ S
Sbjct: 348 GRLEEMINSGLVLLTHCRFFVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCS 407

Query: 419 ATWPK-EVKKLAE 454
           AT    EVKK+AE
Sbjct: 408 ATLHAFEVKKMAE 420



 Score = 36.3 bits (80), Expect = 0.039
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 3/62 (4%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFG-HTS--YVRNTCVFGGAPKREQARDLERGVEIVI 248
           + P A+++ P+RELA+Q       F  H S   VR+  + GG    EQ   L +G  IV+
Sbjct: 285 NAPQAIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVV 344

Query: 249 AT 254
            T
Sbjct: 345 GT 346


>AE014296-3658|AAF51814.1|  727|Drosophila melanogaster CG9054-PA
           protein.
          Length = 727

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 7/73 (9%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE---PQIRKIIEQIRPD---RQTLMWS 418
           GRL + +  G   L  C + VLDEAD +L  G+     ++ K I +I  D    Q ++ S
Sbjct: 348 GRLEEMINSGLVLLTHCRFFVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCS 407

Query: 419 ATWPK-EVKKLAE 454
           AT    EVKK+AE
Sbjct: 408 ATLHAFEVKKMAE 420



 Score = 36.3 bits (80), Expect = 0.039
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 3/62 (4%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFG-HTS--YVRNTCVFGGAPKREQARDLERGVEIVI 248
           + P A+++ P+RELA+Q       F  H S   VR+  + GG    EQ   L +G  IV+
Sbjct: 285 NAPQAIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVV 344

Query: 249 AT 254
            T
Sbjct: 345 GT 346


>U34773-1|AAC47309.1|  725|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 725

 Score = 39.1 bits (87), Expect = 0.006
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 7/73 (9%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFE---PQIRKIIEQIRPD---RQTLMWS 418
           GRL + +  G   L  C + VLDEAD +L  G+     ++ K I +I  D    Q ++ S
Sbjct: 347 GRLEEMINSGLVLLTHCGFFVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCS 406

Query: 419 ATWPK-EVKKLAE 454
           AT    EVKK+AE
Sbjct: 407 ATLHAFEVKKMAE 419



 Score = 36.3 bits (80), Expect = 0.039
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 3/62 (4%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFG-HTS--YVRNTCVFGGAPKREQARDLERGVEIVI 248
           + P A+++ P+RELA+Q       F  H S   VR+  + GG    EQ   L +G  IV+
Sbjct: 284 NAPQAIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVV 343

Query: 249 AT 254
            T
Sbjct: 344 GT 345


>BT010296-1|AAQ23614.1|  813|Drosophila melanogaster LD11580p
           protein.
          Length = 813

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = +3

Query: 93  LVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           LVL PTRELA Q++         + +R   +FGG    +Q R L +  +IV+AT
Sbjct: 344 LVLTPTRELAVQVKNHLVAAAKYTGIRVAAIFGGLAVAKQERVLRQCPDIVVAT 397



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 9/65 (13%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRC---TYLVLDEADRMLDMGFEPQIRKII------EQIRPDRQTL 409
           GRL +   +G  +L +    ++LV+DE DRM++ G   ++R ++      EQ +  RQ  
Sbjct: 399 GRLWELYAQGNRHLGKIEDVSFLVIDETDRMVEKGHFEELRSLLKVLNSDEQKKHQRQNF 458

Query: 410 MWSAT 424
           ++SAT
Sbjct: 459 VYSAT 463


>AE013599-2990|AAF57487.1|  813|Drosophila melanogaster CG9143-PA
           protein.
          Length = 813

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = +3

Query: 93  LVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           LVL PTRELA Q++         + +R   +FGG    +Q R L +  +IV+AT
Sbjct: 344 LVLTPTRELAVQVKNHLVAAAKYTGIRVAAIFGGLAVAKQERVLRQCPDIVVAT 397



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 9/65 (13%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRC---TYLVLDEADRMLDMGFEPQIRKII------EQIRPDRQTL 409
           GRL +   +G  +L +    ++LV+DE DRM++ G   ++R ++      EQ +  RQ  
Sbjct: 399 GRLWELYAQGNRHLGKIEDVSFLVIDETDRMVEKGHFEELRSLLKVLNSDEQKKHQRQNF 458

Query: 410 MWSAT 424
           ++SAT
Sbjct: 459 VYSAT 463


>AY071389-1|AAL49011.1|  288|Drosophila melanogaster RE44177p
           protein.
          Length = 288

 Score = 38.3 bits (85), Expect = 0.010
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 2/73 (2%)
 Frame = +2

Query: 257 GRLIDF-LEKGTTNLQRCTYLVLDEADRML-DMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           G+L+D+ ++    ++++ +  VLDEAD M+   G   Q  +I + + P  Q L +SAT+ 
Sbjct: 200 GKLLDWGIKFRLFDMKKISVFVLDEADVMIATQGHHDQCIRIHKMLNPHCQMLFFSATYG 259

Query: 431 KEVKKLAEDYLGD 469
           KEV   A   + D
Sbjct: 260 KEVMDFARLIVAD 272



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  +N        + P  L L+PT ELA Q  +VAA  G
Sbjct: 122 GTGKTAAFVLAMLSRVNVCL-----NHPQVLCLSPTYELAIQTGEVAARMG 167


>AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box
           helicase protein.
          Length = 460

 Score = 38.3 bits (85), Expect = 0.010
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 2/73 (2%)
 Frame = +2

Query: 257 GRLIDF-LEKGTTNLQRCTYLVLDEADRML-DMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           G+L+D+ ++    ++++ +  VLDEAD M+   G   Q  +I + + P  Q L +SAT+ 
Sbjct: 200 GKLLDWGIKFRLFDMKKISVFVLDEADVMIATQGHHDQCIRIHKMLNPHCQMLFFSATYG 259

Query: 431 KEVKKLAEDYLGD 469
           KEV   A   + D
Sbjct: 260 KEVMDFARLIVAD 272



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT A++L  +  +N        + P  L L+PT ELA Q  +VAA  G
Sbjct: 122 GTGKTAAFVLAMLSRVNVCL-----NHPQVLCLSPTYELAIQTGEVAARMG 167


>AY113641-1|AAM29646.1|  388|Drosophila melanogaster RH74035p
           protein.
          Length = 388

 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +2

Query: 263 LIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEV 439
           L+ + E G+  +L+    LV+DEAD +   G+E   +++I+ + P  Q ++ SAT   +V
Sbjct: 146 LLAYAEAGSVVDLKHVETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLTDDV 205

Query: 440 KKL 448
            ++
Sbjct: 206 ARM 208



 Score = 36.7 bits (81), Expect = 0.029
 Identities = 21/46 (45%), Positives = 26/46 (56%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQV 140
           GSGKT  Y LP I  I N           A+VLAPT+EL +Q ++V
Sbjct: 56  GSGKTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKV 101


>AY070624-1|AAL48095.1|  560|Drosophila melanogaster RE72861p
           protein.
          Length = 560

 Score = 37.1 bits (82), Expect = 0.022
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +2

Query: 263 LIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEV 439
           L+ + E G+  +L+    LV+DEAD +   G+E   +++I+ + P  Q ++ SAT   +V
Sbjct: 146 LLAYAEAGSVVDLKHVETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLTDDV 205

Query: 440 KKL 448
            ++
Sbjct: 206 VRM 208



 Score = 36.7 bits (81), Expect = 0.029
 Identities = 21/46 (45%), Positives = 26/46 (56%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQV 140
           GSGKT  Y LP I  I N           A+VLAPT+EL +Q ++V
Sbjct: 56  GSGKTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKV 101


>AF017777-10|AAC28406.1|  560|Drosophila melanogaster helicase
           protein.
          Length = 560

 Score = 37.1 bits (82), Expect = 0.022
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +2

Query: 263 LIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEV 439
           L+ + E G+  +L+    LV+DEAD +   G+E   +++I+ + P  Q ++ SAT   +V
Sbjct: 146 LLAYAEAGSVVDLKHVETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLTDDV 205

Query: 440 KKL 448
            ++
Sbjct: 206 VRM 208



 Score = 36.7 bits (81), Expect = 0.029
 Identities = 21/46 (45%), Positives = 26/46 (56%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQV 140
           GSGKT  Y LP I  I N           A+VLAPT+EL +Q ++V
Sbjct: 56  GSGKTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKV 101


>AE014298-3138|AAF50818.2|  560|Drosophila melanogaster CG1666-PA
           protein.
          Length = 560

 Score = 37.1 bits (82), Expect = 0.022
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +2

Query: 263 LIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEV 439
           L+ + E G+  +L+    LV+DEAD +   G+E   +++I+ + P  Q ++ SAT   +V
Sbjct: 146 LLAYAEAGSVVDLKHVETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLTDDV 205

Query: 440 KKL 448
            ++
Sbjct: 206 VRM 208



 Score = 36.7 bits (81), Expect = 0.029
 Identities = 21/46 (45%), Positives = 26/46 (56%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQV 140
           GSGKT  Y LP I  I N           A+VLAPT+EL +Q ++V
Sbjct: 56  GSGKTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKV 101


>AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD05563
           protein.
          Length = 1028

 Score = 36.3 bits (80), Expect = 0.039
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+   E    ++ +   LVLDEAD++      +  + K+IE +  +RQ +  SAT+ +
Sbjct: 152 GRLLHLYENRVFDVSKLRLLVLDEADQLYQTKSLQHTVSKLIEAMPKNRQIIACSATYDQ 211

Query: 434 EV-KKLAE 454
            + ++LA+
Sbjct: 212 NLDERLAK 219



 Score = 35.9 bits (79), Expect = 0.051
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQ 134
           G+GKTL Y++  +   N  P I +   P A+++ PTRELA Q+Q
Sbjct: 72  GTGKTLIYVIAVVQSFN--PNINQ---PHAMIVVPTRELAIQVQ 110


>AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA
           protein.
          Length = 1028

 Score = 36.3 bits (80), Expect = 0.039
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+   E    ++ +   LVLDEAD++      +  + K+IE +  +RQ +  SAT+ +
Sbjct: 152 GRLLHLYENRVFDVSKLRLLVLDEADQLYQTKSLQHTVSKLIEAMPKNRQIIACSATYDQ 211

Query: 434 EV-KKLAE 454
            + ++LA+
Sbjct: 212 NLDERLAK 219



 Score = 35.9 bits (79), Expect = 0.051
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQ 134
           G+GKTL Y++  +   N  P I +   P A+++ PTRELA Q+Q
Sbjct: 72  GTGKTLIYVIAVVQSFN--PNINQ---PHAMIVVPTRELAIQVQ 110


>M74824-1|AAC14192.1|  644|Drosophila melanogaster D-E-A-D box
           protein protein.
          Length = 644

 Score = 31.9 bits (69), Expect = 0.83
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQIQQVAAD 149
           GSGKTLA+ +P IV + +Q    R D  + ALV+ P  ELA Q+ +V ++
Sbjct: 193 GSGKTLAFAIP-IVQLLSQ----RVDCKVRALVVLPVAELALQVYRVISE 237



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLM 412
           GRL+D L   KG   L+   +LV+DEADR++D  F+  +  +   ++     L+
Sbjct: 282 GRLVDHLHATKGFC-LKSLKFLVIDEADRIMDAVFQNWLYHLDSHVKETTDQLL 334


>BT010045-1|AAQ22514.1|  687|Drosophila melanogaster LD27814p
           protein.
          Length = 687

 Score = 31.9 bits (69), Expect = 0.83
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQIQQVAAD 149
           GSGKTLA+ +P IV + +Q    R D  + ALV+ P  ELA Q+ +V ++
Sbjct: 193 GSGKTLAFAIP-IVQLLSQ----RVDCKVRALVVLPVAELALQVYRVISE 237



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLM 412
           GRL+D L   KG   L+   +LV+DEADR++D  F+  +  +   ++     L+
Sbjct: 282 GRLVDHLHATKGFC-LKSLKFLVIDEADRIMDAVFQNWLYHLDSHVKETTDQLL 334


>AF132173-1|AAD34761.1|  687|Drosophila melanogaster unknown
           protein.
          Length = 687

 Score = 31.9 bits (69), Expect = 0.83
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQIQQVAAD 149
           GSGKTLA+ +P IV + +Q    R D  + ALV+ P  ELA Q+ +V ++
Sbjct: 193 GSGKTLAFAIP-IVQLLSQ----RVDCKVRALVVLPVAELALQVYRVISE 237



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLM 412
           GRL+D L   KG   L+   +LV+DEADR++D  F+  +  +   ++     L+
Sbjct: 282 GRLVDHLHATKGFC-LKSLKFLVIDEADRIMDAVFQNWLYHLDSHVKETTDQLL 334


>AE014296-2792|AAF49419.1|  687|Drosophila melanogaster CG9680-PA
           protein.
          Length = 687

 Score = 31.9 bits (69), Expect = 0.83
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQIQQVAAD 149
           GSGKTLA+ +P IV + +Q    R D  + ALV+ P  ELA Q+ +V ++
Sbjct: 193 GSGKTLAFAIP-IVQLLSQ----RVDCKVRALVVLPVAELALQVYRVISE 237



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLM 412
           GRL+D L   KG   L+   +LV+DEADR++D  F+  +  +   ++     L+
Sbjct: 282 GRLVDHLHATKGFC-LKSLKFLVIDEADRIMDAVFQNWLYHLDSHVKETTDQLL 334


>BT029142-1|ABJ17075.1| 1613|Drosophila melanogaster RE40504p
           protein.
          Length = 1613

 Score = 29.9 bits (64), Expect = 3.4
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = -2

Query: 341 TYDQPHQELNMCTAVSWLCPFPRNQLIYLSSNDYFYSPLQVPGLLSFRSTTKH 183
           ++ Q HQ+L   T    L P P   L   SS  + +SPL +     + S+T++
Sbjct: 819 SFQQRHQQLATSTLTRSLSPIPSPTLNTRSSEVHTHSPLTIKTSNQYESSTRN 871


>AE013599-3459|AAF46896.3| 1622|Drosophila melanogaster CG30092-PB,
           isoform B protein.
          Length = 1622

 Score = 29.9 bits (64), Expect = 3.4
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = -2

Query: 341 TYDQPHQELNMCTAVSWLCPFPRNQLIYLSSNDYFYSPLQVPGLLSFRSTTKH 183
           ++ Q HQ+L   T    L P P   L   SS  + +SPL +     + S+T++
Sbjct: 828 SFQQRHQQLATSTLTRSLSPIPSPTLNTRSSEVHTHSPLTIKTSNQYESSTRN 880


>AE013599-3458|AAF46895.4| 2964|Drosophila melanogaster CG30092-PD,
           isoform D protein.
          Length = 2964

 Score = 29.9 bits (64), Expect = 3.4
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = -2

Query: 341 TYDQPHQELNMCTAVSWLCPFPRNQLIYLSSNDYFYSPLQVPGLLSFRSTTKH 183
           ++ Q HQ+L   T    L P P   L   SS  + +SPL +     + S+T++
Sbjct: 828 SFQQRHQQLATSTLTRSLSPIPSPTLNTRSSEVHTHSPLTIKTSNQYESSTRN 880


>AE013599-3630|AAF47029.1| 1000|Drosophila melanogaster CG5372-PA
           protein.
          Length = 1000

 Score = 28.7 bits (61), Expect = 7.8
 Identities = 13/51 (25%), Positives = 27/51 (52%)
 Frame = +3

Query: 84  PIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGV 236
           P  ++ AP     + IQ  ++ FG++  +R T +F GAP+ +   + +  +
Sbjct: 7   PNRVIDAPKHLKTRMIQVRSSYFGYSLVIRPTSIFVGAPRAQSTLESQGSI 57


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,922,876
Number of Sequences: 53049
Number of extensions: 698067
Number of successful extensions: 2037
Number of sequences better than 10.0: 103
Number of HSP's better than 10.0 without gapping: 1792
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1981
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2971922400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -