SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT021417-1|AAX33565.1|  420|Drosophila melanogaster LD04387p pro...    32   0.79 
AE014296-2922|AAF49330.1|  420|Drosophila melanogaster CG7564-PA...    32   0.79 
BT023281-1|AAY55697.1|  304|Drosophila melanogaster IP02562p pro...    31   1.4  
AE014134-1261|AAF52502.1|  338|Drosophila melanogaster CG4969-PA...    31   1.4  
AY119578-1|AAM50232.1|  490|Drosophila melanogaster LD07162p pro...    31   1.8  
AY118843-1|AAM50703.1|  330|Drosophila melanogaster GM13395p pro...    31   1.8  
AE014134-2563|AAN10889.1|  490|Drosophila melanogaster CG4170-PD...    31   1.8  
AE014134-2562|AAN10888.1|  490|Drosophila melanogaster CG4170-PC...    31   1.8  
AE014134-2561|AAN10887.1|  490|Drosophila melanogaster CG4170-PB...    31   1.8  
AE014134-2560|AAF53437.1|  490|Drosophila melanogaster CG4170-PA...    31   1.8  
AE013599-807|AAF58976.3|  330|Drosophila melanogaster CG30342-PA...    31   1.8  
AE014296-1288|AAN12044.1|  923|Drosophila melanogaster CG14837-P...    29   4.2  
DQ375488-1|ABD33837.1|  290|Drosophila melanogaster nubbin protein.    29   5.6  
BT024970-1|ABE01200.1|  281|Drosophila melanogaster IP15218p pro...    28   9.8  
BT010075-1|AAQ22544.1|  224|Drosophila melanogaster LD10274p pro...    28   9.8  
AY119553-1|AAM50207.1|  878|Drosophila melanogaster GH27971p pro...    28   9.8  
AJ620302-1|CAF04325.1|  287|Drosophila melanogaster THO complex ...    28   9.8  
AF020348-1|AAC15517.1|  891|Drosophila melanogaster CROL BETA pr...    28   9.8  
AF020347-1|AAC15516.1|  962|Drosophila melanogaster CROL ALPHA p...    28   9.8  
AE014296-335|AAF47551.2|  858|Drosophila melanogaster CG7991-PA ...    28   9.8  
AE014296-41|AAF47350.1|  224|Drosophila melanogaster CG17143-PA,...    28   9.8  
AE014296-40|AAN11424.1|  287|Drosophila melanogaster CG17143-PB,...    28   9.8  
AE014134-2098|AAF53121.2|  962|Drosophila melanogaster CG14938-P...    28   9.8  
AE014134-2097|AAN10786.1|  891|Drosophila melanogaster CG14938-P...    28   9.8  
AE014134-2096|AAN10785.1|  878|Drosophila melanogaster CG14938-P...    28   9.8  
AE013599-118|AAF57301.2| 1976|Drosophila melanogaster CG14470-PA...    28   9.8  

>BT021417-1|AAX33565.1|  420|Drosophila melanogaster LD04387p
           protein.
          Length = 420

 Score = 31.9 bits (69), Expect = 0.79
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 6/53 (11%)
 Frame = +2

Query: 41  SRFDDKQSPEDGRVQGHDG------AADGPERERPVHHRGGRDRQPGRHHGGD 181
           +R  D++ P +GR     G      AADGPER      RGGR R    +HG D
Sbjct: 287 NRDGDRERPNNGRGPEEKGSERPKEAADGPERAERAPDRGGR-RDDRDNHGRD 338


>AE014296-2922|AAF49330.1|  420|Drosophila melanogaster CG7564-PA
           protein.
          Length = 420

 Score = 31.9 bits (69), Expect = 0.79
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 6/53 (11%)
 Frame = +2

Query: 41  SRFDDKQSPEDGRVQGHDG------AADGPERERPVHHRGGRDRQPGRHHGGD 181
           +R  D++ P +GR     G      AADGPER      RGGR R    +HG D
Sbjct: 287 NRDGDRERPNNGRGPEEKGSERPKEAADGPERAERAPDRGGR-RDDRDNHGRD 338


>BT023281-1|AAY55697.1|  304|Drosophila melanogaster IP02562p
           protein.
          Length = 304

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%)
 Frame = +2

Query: 125 PVHHRGGRDRQPGRHHGGDE--DRVRLP 202
           PV HRGGR+R+PG   G  +  D ++ P
Sbjct: 75  PVEHRGGRNRRPGGRRGRRKFWDNIKFP 102


>AE014134-1261|AAF52502.1|  338|Drosophila melanogaster CG4969-PA
           protein.
          Length = 338

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%)
 Frame = +2

Query: 125 PVHHRGGRDRQPGRHHGGDE--DRVRLP 202
           PV HRGGR+R+PG   G  +  D ++ P
Sbjct: 109 PVEHRGGRNRRPGGRRGRRKFWDNIKFP 136


>AY119578-1|AAM50232.1|  490|Drosophila melanogaster LD07162p
           protein.
          Length = 490

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = +2

Query: 29  GARYSRFDDKQSPEDGRVQGHDGAADGPERER-PVHHRG-GRDRQPGRHHG-GDEDRVRL 199
           G R +R    + P DG+   ++G     + +R P+  RG G ++   ++ G G   R   
Sbjct: 413 GGRDNREGGNRGPRDGQQHNNEGGGSSAQNQRPPIDRRGPGNNQNNNQNSGPGPNKRFER 472

Query: 200 PGTTSPK 220
              T+PK
Sbjct: 473 QQNTAPK 479


>AY118843-1|AAM50703.1|  330|Drosophila melanogaster GM13395p
           protein.
          Length = 330

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/57 (31%), Positives = 26/57 (45%)
 Frame = +2

Query: 26  HGARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVR 196
           +  R+ R  ++Q  +  R +  DG  D  +RER      GR  Q  R   G+ DR R
Sbjct: 273 NNGRHDRERERQDRDSIRERERDGDRDRRDRERERERDRGRHDQRERDSRGERDRRR 329


>AE014134-2563|AAN10889.1|  490|Drosophila melanogaster CG4170-PD,
           isoform D protein.
          Length = 490

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = +2

Query: 29  GARYSRFDDKQSPEDGRVQGHDGAADGPERER-PVHHRG-GRDRQPGRHHG-GDEDRVRL 199
           G R +R    + P DG+   ++G     + +R P+  RG G ++   ++ G G   R   
Sbjct: 413 GGRDNREGGNRGPRDGQQHNNEGGGSSAQNQRPPIDRRGPGNNQNNNQNSGPGPNKRFER 472

Query: 200 PGTTSPK 220
              T+PK
Sbjct: 473 QQNTAPK 479


>AE014134-2562|AAN10888.1|  490|Drosophila melanogaster CG4170-PC,
           isoform C protein.
          Length = 490

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = +2

Query: 29  GARYSRFDDKQSPEDGRVQGHDGAADGPERER-PVHHRG-GRDRQPGRHHG-GDEDRVRL 199
           G R +R    + P DG+   ++G     + +R P+  RG G ++   ++ G G   R   
Sbjct: 413 GGRDNREGGNRGPRDGQQHNNEGGGSSAQNQRPPIDRRGPGNNQNNNQNSGPGPNKRFER 472

Query: 200 PGTTSPK 220
              T+PK
Sbjct: 473 QQNTAPK 479


>AE014134-2561|AAN10887.1|  490|Drosophila melanogaster CG4170-PB,
           isoform B protein.
          Length = 490

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = +2

Query: 29  GARYSRFDDKQSPEDGRVQGHDGAADGPERER-PVHHRG-GRDRQPGRHHG-GDEDRVRL 199
           G R +R    + P DG+   ++G     + +R P+  RG G ++   ++ G G   R   
Sbjct: 413 GGRDNREGGNRGPRDGQQHNNEGGGSSAQNQRPPIDRRGPGNNQNNNQNSGPGPNKRFER 472

Query: 200 PGTTSPK 220
              T+PK
Sbjct: 473 QQNTAPK 479


>AE014134-2560|AAF53437.1|  490|Drosophila melanogaster CG4170-PA,
           isoform A protein.
          Length = 490

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = +2

Query: 29  GARYSRFDDKQSPEDGRVQGHDGAADGPERER-PVHHRG-GRDRQPGRHHG-GDEDRVRL 199
           G R +R    + P DG+   ++G     + +R P+  RG G ++   ++ G G   R   
Sbjct: 413 GGRDNREGGNRGPRDGQQHNNEGGGSSAQNQRPPIDRRGPGNNQNNNQNSGPGPNKRFER 472

Query: 200 PGTTSPK 220
              T+PK
Sbjct: 473 QQNTAPK 479


>AE013599-807|AAF58976.3|  330|Drosophila melanogaster CG30342-PA
           protein.
          Length = 330

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/57 (31%), Positives = 26/57 (45%)
 Frame = +2

Query: 26  HGARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVR 196
           +  R+ R  ++Q  +  R +  DG  D  +RER      GR  Q  R   G+ DR R
Sbjct: 273 NNGRHDRERERQDRDSIRERERDGDRDRRDRERERERDRGRHDQRERDSRGERDRRR 329


>AE014296-1288|AAN12044.1|  923|Drosophila melanogaster CG14837-PB,
           isoform B protein.
          Length = 923

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 23/96 (23%), Positives = 35/96 (36%)
 Frame = +2

Query: 137 RGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQ 316
           R    RQP +  G      + P     KF+  +    + F + +    + +N+ H  ET 
Sbjct: 146 RNAESRQPCQTEGRGRRGSKFPLNAKKKFDTSSRNVCNKFGRTS---HYYNNKPHASETL 202

Query: 317 MKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEA 424
              L     T   + A    E+  A     Q LDEA
Sbjct: 203 TTTLDTAKETVGTAVAGITTELGNAFKEGTQALDEA 238


>DQ375488-1|ABD33837.1|  290|Drosophila melanogaster nubbin protein.
          Length = 290

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 1/77 (1%)
 Frame = +3

Query: 63  HLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFAYQEQLAQNLKLMQEN 242
           HLK+ E  +  EQ+ A     +  + G   A    +  A K        L Q LKL   N
Sbjct: 191 HLKLEEQDEQDEQEQAEVKDKVLELTGAAVALYGHLNNASKD----VRDLEQCLKLQDPN 246

Query: 243 -INHLSASKLPLSNTCT 290
            I+ LS S  PL +  +
Sbjct: 247 DISRLSRSPSPLQSNAS 263


>BT024970-1|ABE01200.1|  281|Drosophila melanogaster IP15218p
           protein.
          Length = 281

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 15/67 (22%), Positives = 32/67 (47%)
 Frame = +2

Query: 266 TSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLE 445
           T L+EH      L + +++  K+ ++TA Q   K+  E     S++    D ++  R +E
Sbjct: 91  TQLVEHHEESIVLAKAEIESSKKELITAKQ-IRKNKMEYDLLASLIQDQPDRSETQRHIE 149

Query: 446 PAKVSLE 466
             +  ++
Sbjct: 150 TIRREID 156


>BT010075-1|AAQ22544.1|  224|Drosophila melanogaster LD10274p
           protein.
          Length = 224

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 15/67 (22%), Positives = 32/67 (47%)
 Frame = +2

Query: 266 TSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLE 445
           T L+EH      L + +++  K+ ++TA Q   K+  E     S++    D ++  R +E
Sbjct: 34  TQLVEHHEESIVLAKAEIESSKKELITAKQ-IRKNKMEYDLLASLIQDQPDRSETQRHIE 92

Query: 446 PAKVSLE 466
             +  ++
Sbjct: 93  TIRREID 99


>AY119553-1|AAM50207.1|  878|Drosophila melanogaster GH27971p
           protein.
          Length = 878

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = +3

Query: 510 DNIRQHSGQSQLRCQYSART 569
           ++ R H+G++  RCQY A+T
Sbjct: 322 NHFRSHTGETPFRCQYCAKT 341


>AJ620302-1|CAF04325.1|  287|Drosophila melanogaster THO complex 7
           protein.
          Length = 287

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 15/67 (22%), Positives = 32/67 (47%)
 Frame = +2

Query: 266 TSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLE 445
           T L+EH      L + +++  K+ ++TA Q   K+  E     S++    D ++  R +E
Sbjct: 97  TQLVEHHEESIVLAKAEIESSKKELITAKQ-IRKNKMEYDLLASLIQDQPDRSETQRHIE 155

Query: 446 PAKVSLE 466
             +  ++
Sbjct: 156 TIRREID 162


>AF020348-1|AAC15517.1|  891|Drosophila melanogaster CROL BETA
           protein.
          Length = 891

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = +3

Query: 510 DNIRQHSGQSQLRCQYSART 569
           ++ R H+G++  RCQY A+T
Sbjct: 322 NHFRSHTGETPFRCQYCAKT 341


>AF020347-1|AAC15516.1|  962|Drosophila melanogaster CROL ALPHA
           protein.
          Length = 962

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = +3

Query: 510 DNIRQHSGQSQLRCQYSART 569
           ++ R H+G++  RCQY A+T
Sbjct: 322 NHFRSHTGETPFRCQYCAKT 341


>AE014296-335|AAF47551.2|  858|Drosophila melanogaster CG7991-PA
           protein.
          Length = 858

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = +2

Query: 68  EDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHG 175
           E G V G  G A  P+++R   HR  RDR   +  G
Sbjct: 461 EGGGVGGSGGGAAAPQQQRRHRHRKRRDRNRVQRFG 496


>AE014296-41|AAF47350.1|  224|Drosophila melanogaster CG17143-PA,
           isoform A protein.
          Length = 224

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 15/67 (22%), Positives = 32/67 (47%)
 Frame = +2

Query: 266 TSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLE 445
           T L+EH      L + +++  K+ ++TA Q   K+  E     S++    D ++  R +E
Sbjct: 34  TQLVEHHEESIVLAKAEIESSKKELITAKQ-IRKNKMEYDLLASLIQDQPDRSETQRHIE 92

Query: 446 PAKVSLE 466
             +  ++
Sbjct: 93  TIRREID 99


>AE014296-40|AAN11424.1|  287|Drosophila melanogaster CG17143-PB,
           isoform B protein.
          Length = 287

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 15/67 (22%), Positives = 32/67 (47%)
 Frame = +2

Query: 266 TSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLE 445
           T L+EH      L + +++  K+ ++TA Q   K+  E     S++    D ++  R +E
Sbjct: 97  TQLVEHHEESIVLAKAEIESSKKELITAKQ-IRKNKMEYDLLASLIQDQPDRSETQRHIE 155

Query: 446 PAKVSLE 466
             +  ++
Sbjct: 156 TIRREID 162


>AE014134-2098|AAF53121.2|  962|Drosophila melanogaster CG14938-PA,
           isoform A protein.
          Length = 962

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = +3

Query: 510 DNIRQHSGQSQLRCQYSART 569
           ++ R H+G++  RCQY A+T
Sbjct: 322 NHFRSHTGETPFRCQYCAKT 341


>AE014134-2097|AAN10786.1|  891|Drosophila melanogaster CG14938-PB,
           isoform B protein.
          Length = 891

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = +3

Query: 510 DNIRQHSGQSQLRCQYSART 569
           ++ R H+G++  RCQY A+T
Sbjct: 322 NHFRSHTGETPFRCQYCAKT 341


>AE014134-2096|AAN10785.1|  878|Drosophila melanogaster CG14938-PD,
           isoform D protein.
          Length = 878

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = +3

Query: 510 DNIRQHSGQSQLRCQYSART 569
           ++ R H+G++  RCQY A+T
Sbjct: 322 NHFRSHTGETPFRCQYCAKT 341


>AE013599-118|AAF57301.2| 1976|Drosophila melanogaster CG14470-PA
           protein.
          Length = 1976

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 5/58 (8%)
 Frame = +2

Query: 287 HNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSV---VHQDLDEADKD--RDLE 445
           H QE    T++  L + +VT   S    D + +   SV   VH+++ EA +    DLE
Sbjct: 762 HRQEETETTELPGLTQFLVTTQMSQVDDDVDESTDKSVVESVHENVSEASQSYPTDLE 819


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,594,454
Number of Sequences: 53049
Number of extensions: 669988
Number of successful extensions: 3274
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 2725
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3098
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2827453950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -