SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U15643-1|AAC46585.1|  184|Drosophila melanogaster ribosomal prot...   167   1e-41
BT022593-1|AAY55009.1|  163|Drosophila melanogaster IP06777p pro...   167   1e-41
AY094790-1|AAM11143.1|  184|Drosophila melanogaster LD17235p pro...   167   1e-41
AE013599-2887|AAF57560.1|  184|Drosophila melanogaster CG7726-PA...   167   1e-41
AY069775-1|AAL39920.1| 2171|Drosophila melanogaster SD01562p pro...    29   6.6  
AE013599-2783|AAF57626.1| 2599|Drosophila melanogaster CG15099-P...    29   6.6  
AF132190-1|AAD34778.1| 1398|Drosophila melanogaster unknown prot...    28   8.8  
AE014297-3357|AAN13952.1| 1398|Drosophila melanogaster CG10254-P...    28   8.8  
AE014297-3356|AAF56162.1| 1398|Drosophila melanogaster CG10254-P...    28   8.8  

>U15643-1|AAC46585.1|  184|Drosophila melanogaster ribosomal protein
           DL11 protein.
          Length = 184

 Score =  167 bits (406), Expect = 1e-41
 Identities = 76/84 (90%), Positives = 81/84 (96%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILERGLKVREYELRR+NFS+TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 82  AKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 141

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PG+NV HR+RK+G VGF HRLTKE
Sbjct: 142 PGYNVNHRKRKSGTVGFQHRLTKE 165



 Score =  133 bits (321), Expect = 2e-31
 Identities = 66/82 (80%), Positives = 72/82 (87%), Gaps = 1/82 (1%)
 Frame = +2

Query: 44  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           D ++    +LHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN
Sbjct: 11  DPAQEPDEDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 70

Query: 224 EKIAVHCTVRELKQKKSL-RGV 286
           EKIAVHCTVR  K ++ L RG+
Sbjct: 71  EKIAVHCTVRGAKAEEILERGL 92



 Score = 32.7 bits (71), Expect = 0.41
 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%)
 Frame = +3

Query: 471 RKSGISPPPH---KGSAMKWFQQKYDG 542
           RKSG     H   K  AMKWFQQKYDG
Sbjct: 151 RKSGTVGFQHRLTKEDAMKWFQQKYDG 177


>BT022593-1|AAY55009.1|  163|Drosophila melanogaster IP06777p
           protein.
          Length = 163

 Score =  167 bits (406), Expect = 1e-41
 Identities = 76/84 (90%), Positives = 81/84 (96%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILERGLKVREYELRR+NFS+TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 61  AKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 120

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PG+NV HR+RK+G VGF HRLTKE
Sbjct: 121 PGYNVNHRKRKSGTVGFQHRLTKE 144



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 24/34 (70%), Positives = 27/34 (79%), Gaps = 1/34 (2%)
 Frame = +2

Query: 188 RYTVRSFGIRRNEKIAVHCTVRELKQKKSL-RGV 286
           R  VRSFGIRRNEKIAVHCTVR  K ++ L RG+
Sbjct: 38  RRCVRSFGIRRNEKIAVHCTVRGAKAEEILERGL 71



 Score = 32.7 bits (71), Expect = 0.41
 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%)
 Frame = +3

Query: 471 RKSGISPPPH---KGSAMKWFQQKYDG 542
           RKSG     H   K  AMKWFQQKYDG
Sbjct: 130 RKSGTVGFQHRLTKEDAMKWFQQKYDG 156


>AY094790-1|AAM11143.1|  184|Drosophila melanogaster LD17235p
           protein.
          Length = 184

 Score =  167 bits (406), Expect = 1e-41
 Identities = 76/84 (90%), Positives = 81/84 (96%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILERGLKVREYELRR+NFS+TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 82  AKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 141

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PG+NV HR+RK+G VGF HRLTKE
Sbjct: 142 PGYNVNHRKRKSGTVGFQHRLTKE 165



 Score =  142 bits (344), Expect = 3e-34
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +2

Query: 44  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           D +KN MR+LHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN
Sbjct: 11  DPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 70

Query: 224 EKIAVHCTVRELKQKKSL-RGV 286
           EKIAVHCTVR  K ++ L RG+
Sbjct: 71  EKIAVHCTVRGAKAEEILERGL 92



 Score = 32.7 bits (71), Expect = 0.41
 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%)
 Frame = +3

Query: 471 RKSGISPPPH---KGSAMKWFQQKYDG 542
           RKSG     H   K  AMKWFQQKYDG
Sbjct: 151 RKSGTVGFQHRLTKEDAMKWFQQKYDG 177


>AE013599-2887|AAF57560.1|  184|Drosophila melanogaster CG7726-PA
           protein.
          Length = 184

 Score =  167 bits (406), Expect = 1e-41
 Identities = 76/84 (90%), Positives = 81/84 (96%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILERGLKVREYELRR+NFS+TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 82  AKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 141

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PG+NV HR+RK+G VGF HRLTKE
Sbjct: 142 PGYNVNHRKRKSGTVGFQHRLTKE 165



 Score =  142 bits (344), Expect = 3e-34
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +2

Query: 44  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           D +KN MR+LHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN
Sbjct: 11  DPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 70

Query: 224 EKIAVHCTVRELKQKKSL-RGV 286
           EKIAVHCTVR  K ++ L RG+
Sbjct: 71  EKIAVHCTVRGAKAEEILERGL 92



 Score = 32.7 bits (71), Expect = 0.41
 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 3/27 (11%)
 Frame = +3

Query: 471 RKSGISPPPH---KGSAMKWFQQKYDG 542
           RKSG     H   K  AMKWFQQKYDG
Sbjct: 151 RKSGTVGFQHRLTKEDAMKWFQQKYDG 177


>AY069775-1|AAL39920.1| 2171|Drosophila melanogaster SD01562p
           protein.
          Length = 2171

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -2

Query: 157 ELLQHLGGTSQPVTGFTNTDVQAKLSDMKIPHYI 56
           ELL HLG   Q   GF  T ++  L  + +PHY+
Sbjct: 626 ELLWHLGRDKQTARGFEKTLLKV-LDTLALPHYM 658


>AE013599-2783|AAF57626.1| 2599|Drosophila melanogaster CG15099-PA
            protein.
          Length = 2599

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -2

Query: 157  ELLQHLGGTSQPVTGFTNTDVQAKLSDMKIPHYI 56
            ELL HLG   Q   GF  T ++  L  + +PHY+
Sbjct: 1054 ELLWHLGRDKQTARGFEKTLLKV-LDTLALPHYM 1086


>AF132190-1|AAD34778.1| 1398|Drosophila melanogaster unknown
           protein.
          Length = 1398

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 26  GEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQL 157
           G +GSED+ +    N HI     +  +    DR T A KVLE++
Sbjct: 722 GSDGSEDSWETESENSHISSSDNDDDILTGIDRATEAMKVLEKM 765


>AE014297-3357|AAN13952.1| 1398|Drosophila melanogaster CG10254-PB,
           isoform B protein.
          Length = 1398

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 26  GEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQL 157
           G +GSED+ +    N HI     +  +    DR T A KVLE++
Sbjct: 722 GSDGSEDSWETESENSHISSSDNDDDILTGIDRATEAMKVLEKM 765


>AE014297-3356|AAF56162.1| 1398|Drosophila melanogaster CG10254-PA,
           isoform A protein.
          Length = 1398

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 26  GEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQL 157
           G +GSED+ +    N HI     +  +    DR T A KVLE++
Sbjct: 722 GSDGSEDSWETESENSHISSSDNDDDILTGIDRATEAMKVLEKM 765


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,034,813
Number of Sequences: 53049
Number of extensions: 564641
Number of successful extensions: 1335
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1302
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1335
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2538517050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -