SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120005.Seq
         (647 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT023115-1|AAY55531.1|  406|Drosophila melanogaster IP10861p pro...    30   2.4  
BT023063-1|AAY55479.1|  407|Drosophila melanogaster IP10961p pro...    30   2.4  
AE013599-627|AAF59107.2|  399|Drosophila melanogaster CG30371-PA...    30   2.4  
U81788-1|AAB50404.1| 1921|Drosophila melanogaster kinesin-73 pro...    28   9.5  
BT011189-1|AAR88550.1| 1108|Drosophila melanogaster LP11192p pro...    28   9.5  
AE013599-2071|AAF58129.1| 1921|Drosophila melanogaster CG8183-PB...    28   9.5  
AE013599-2070|AAM70975.1| 1921|Drosophila melanogaster CG8183-PA...    28   9.5  

>BT023115-1|AAY55531.1|  406|Drosophila melanogaster IP10861p
           protein.
          Length = 406

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +3

Query: 369 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 497
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 223 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 265


>BT023063-1|AAY55479.1|  407|Drosophila melanogaster IP10961p
           protein.
          Length = 407

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +3

Query: 369 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 497
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 224 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 266


>AE013599-627|AAF59107.2|  399|Drosophila melanogaster CG30371-PA
           protein.
          Length = 399

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +3

Query: 369 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 497
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 216 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 258


>U81788-1|AAB50404.1| 1921|Drosophila melanogaster kinesin-73
           protein.
          Length = 1921

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = +3

Query: 294 DNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFN-LNSMMQAEQLIFHLIYNNEEAVN 470
           D+     +  +L GN    +   + PSA NY+E  + L    +A++++ H + N +    
Sbjct: 306 DSVLTWLLKDNLGGNSRTVMVATISPSADNYEETLSTLRYADRAKRIVNHAVVNEDPNAR 365

Query: 471 VI 476
           +I
Sbjct: 366 II 367


>BT011189-1|AAR88550.1| 1108|Drosophila melanogaster LP11192p
           protein.
          Length = 1108

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = +3

Query: 294 DNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFN-LNSMMQAEQLIFHLIYNNEEAVN 470
           D+     +  +L GN    +   + PSA NY+E  + L    +A++++ H + N +    
Sbjct: 306 DSVLTWLLKDNLGGNSRTVMVATISPSADNYEETLSTLRYADRAKRIVNHAVVNEDPNAR 365

Query: 471 VI 476
           +I
Sbjct: 366 II 367


>AE013599-2071|AAF58129.1| 1921|Drosophila melanogaster CG8183-PB,
           isoform B protein.
          Length = 1921

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = +3

Query: 294 DNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFN-LNSMMQAEQLIFHLIYNNEEAVN 470
           D+     +  +L GN    +   + PSA NY+E  + L    +A++++ H + N +    
Sbjct: 306 DSVLTWLLKDNLGGNSRTVMVATISPSADNYEETLSTLRYADRAKRIVNHAVVNEDPNAR 365

Query: 471 VI 476
           +I
Sbjct: 366 II 367


>AE013599-2070|AAM70975.1| 1921|Drosophila melanogaster CG8183-PA,
           isoform A protein.
          Length = 1921

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = +3

Query: 294 DNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFN-LNSMMQAEQLIFHLIYNNEEAVN 470
           D+     +  +L GN    +   + PSA NY+E  + L    +A++++ H + N +    
Sbjct: 306 DSVLTWLLKDNLGGNSRTVMVATISPSADNYEETLSTLRYADRAKRIVNHAVVNEDPNAR 365

Query: 471 VI 476
           +I
Sbjct: 366 II 367


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,258,585
Number of Sequences: 53049
Number of extensions: 557245
Number of successful extensions: 1397
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1360
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1397
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2744900550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -