SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120004.Seq
         (720 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT023115-1|AAY55531.1|  406|Drosophila melanogaster IP10861p pro...    30   2.8  
BT023063-1|AAY55479.1|  407|Drosophila melanogaster IP10961p pro...    30   2.8  
AE013599-627|AAF59107.2|  399|Drosophila melanogaster CG30371-PA...    30   2.8  
AY051935-1|AAK93359.1|  721|Drosophila melanogaster LD41558p pro...    29   4.8  
AE014134-2486|AAF53389.1|  721|Drosophila melanogaster CG7516-PA...    29   4.8  
M74121-1|AAC41573.1| 1293|Drosophila melanogaster maleless prote...    29   6.4  
AE013599-123|AAF57297.1| 1293|Drosophila melanogaster CG11680-PA...    29   6.4  

>BT023115-1|AAY55531.1|  406|Drosophila melanogaster IP10861p
           protein.
          Length = 406

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +3

Query: 369 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 497
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 223 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 265


>BT023063-1|AAY55479.1|  407|Drosophila melanogaster IP10961p
           protein.
          Length = 407

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +3

Query: 369 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 497
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 224 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 266


>AE013599-627|AAF59107.2|  399|Drosophila melanogaster CG30371-PA
           protein.
          Length = 399

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +3

Query: 369 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 497
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 216 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 258


>AY051935-1|AAK93359.1|  721|Drosophila melanogaster LD41558p
           protein.
          Length = 721

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 420 AEQLIFHLIYNN-EEAVNVICDNLKYTEVSQRHATRYTQRLRNYKKHSRHHKPEHVLF 590
           AE   F +I ++  + V + CD  +Y E+   H   Y  R+  + +  ++HKP   +F
Sbjct: 95  AEVTTFEVISDDYSKMVFLQCD--RYVEIHAAHGRHYRLRIPRFGRDMKYHKPSCDMF 150


>AE014134-2486|AAF53389.1|  721|Drosophila melanogaster CG7516-PA
           protein.
          Length = 721

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 420 AEQLIFHLIYNN-EEAVNVICDNLKYTEVSQRHATRYTQRLRNYKKHSRHHKPEHVLF 590
           AE   F +I ++  + V + CD  +Y E+   H   Y  R+  + +  ++HKP   +F
Sbjct: 95  AEVTTFEVISDDYSKMVFLQCD--RYVEIHAAHGRHYRLRIPRFGRDMKYHKPSCDMF 150


>M74121-1|AAC41573.1| 1293|Drosophila melanogaster maleless protein
           protein.
          Length = 1293

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 2/74 (2%)
 Frame = +3

Query: 333 GNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLI--YNNEEAVNVICDNLKYTEVS 506
           GN+   I RI      N  E F++N+ +     I +     N  +  N I D+ KYT V 
Sbjct: 134 GNRYSVIDRIQEQRDMNEAEAFDVNAAIHGNWTIENAKERLNIYKQTNNIRDDYKYTPVG 193

Query: 507 QRHATRYTQRLRNY 548
             HA  +   L  Y
Sbjct: 194 PEHARSFLAELSIY 207


>AE013599-123|AAF57297.1| 1293|Drosophila melanogaster CG11680-PA,
           isoform A protein.
          Length = 1293

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 2/74 (2%)
 Frame = +3

Query: 333 GNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLI--YNNEEAVNVICDNLKYTEVS 506
           GN+   I RI      N  E F++N+ +     I +     N  +  N I D+ KYT V 
Sbjct: 134 GNRYSVIDRIQEQRDMNEAEAFDVNAAIHGNWTIENAKERLNIYKQTNNIRDDYKYTPVG 193

Query: 507 QRHATRYTQRLRNY 548
             HA  +   L  Y
Sbjct: 194 PEHARSFLAELSIY 207


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,060,042
Number of Sequences: 53049
Number of extensions: 630935
Number of successful extensions: 1599
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1564
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1599
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3211306956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -