SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U45881-1|AAC46988.1|  498|Drosophila melanogaster inhibitor of a...    34   0.23 
U38809-1|AAB08398.1|  482|Drosophila melanogaster DIHA protein.        34   0.23 
U32373-1|AAC47155.1|  497|Drosophila melanogaster IAP-like prote...    34   0.23 
L49441-1|AAC41610.1|  498|Drosophila melanogaster apoptosis 2 in...    34   0.23 
AY051844-1|AAK93268.1|  498|Drosophila melanogaster LD34777p pro...    34   0.23 
AE013599-2132|AAO41389.1|  498|Drosophila melanogaster CG8293-PB...    34   0.23 
AE013599-2131|AAF58095.1|  498|Drosophila melanogaster CG8293-PA...    34   0.23 

>U45881-1|AAC46988.1|  498|Drosophila melanogaster inhibitor of
           apoptosis protein protein.
          Length = 498

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           ++L   G  Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/40 (32%), Positives = 17/40 (42%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    DHV C +C   I  W +++     H    P C
Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>U38809-1|AAB08398.1|  482|Drosophila melanogaster DIHA protein.
          Length = 482

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           ++L   G  Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 215 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 262



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/40 (32%), Positives = 17/40 (42%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    DHV C +C   I  W +++     H    P C
Sbjct: 121 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 160


>U32373-1|AAC47155.1|  497|Drosophila melanogaster IAP-like protein
           ILP protein.
          Length = 497

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           ++L   G  Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/40 (32%), Positives = 17/40 (42%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    DHV C +C   I  W +++     H    P C
Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>L49441-1|AAC41610.1|  498|Drosophila melanogaster apoptosis 2
           inhibitor protein.
          Length = 498

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           ++L   G  Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/40 (32%), Positives = 17/40 (42%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    DHV C +C   I  W +++     H    P C
Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>AY051844-1|AAK93268.1|  498|Drosophila melanogaster LD34777p
           protein.
          Length = 498

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           ++L   G  Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/40 (32%), Positives = 17/40 (42%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    DHV C +C   I  W +++     H    P C
Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>AE013599-2132|AAO41389.1|  498|Drosophila melanogaster CG8293-PB,
           isoform B protein.
          Length = 498

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           ++L   G  Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/40 (32%), Positives = 17/40 (42%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    DHV C +C   I  W +++     H    P C
Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>AE013599-2131|AAF58095.1|  498|Drosophila melanogaster CG8293-PA,
           isoform A protein.
          Length = 498

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           ++L   G  Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/40 (32%), Positives = 17/40 (42%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    DHV C +C   I  W +++     H    P C
Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,080,820
Number of Sequences: 53049
Number of extensions: 565472
Number of successful extensions: 1962
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1906
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1962
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3293648160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -