SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061505-1|AAL29053.1|  766|Drosophila melanogaster LD46269p pro...    58   9e-09
AE014134-3350|AAF53971.1|  766|Drosophila melanogaster CG9246-PA...    58   9e-09
DQ138848-1|ABA86454.1| 1047|Drosophila melanogaster CG32217 prot...    33   0.40 
BT023955-1|ABB36459.1|  808|Drosophila melanogaster AT31092p pro...    33   0.40 
AF416770-1|AAL13036.1| 1060|Drosophila melanogaster ELL protein.       33   0.40 
AE014296-3241|AAF49098.3| 1059|Drosophila melanogaster CG32217-P...    33   0.40 

>AY061505-1|AAL29053.1|  766|Drosophila melanogaster LD46269p
           protein.
          Length = 766

 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 25/37 (67%), Positives = 32/37 (86%)
 Frame = -2

Query: 721 IAKMALRKLILLWSTSEETVRVLAFLCILRITRNQQA 611
           + K  L++L++LWST +ETVRVLAFLCIL+ITR QQA
Sbjct: 307 LGKTILKRLVVLWSTGDETVRVLAFLCILKITRKQQA 343


>AE014134-3350|AAF53971.1|  766|Drosophila melanogaster CG9246-PA
           protein.
          Length = 766

 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 25/37 (67%), Positives = 32/37 (86%)
 Frame = -2

Query: 721 IAKMALRKLILLWSTSEETVRVLAFLCILRITRNQQA 611
           + K  L++L++LWST +ETVRVLAFLCIL+ITR QQA
Sbjct: 307 LGKTILKRLVVLWSTGDETVRVLAFLCILKITRKQQA 343


>DQ138848-1|ABA86454.1| 1047|Drosophila melanogaster CG32217
           protein.
          Length = 1047

 Score = 33.1 bits (72), Expect = 0.40
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 405 YVKTMFETIKPKKDLRISVYLNDKPAQGWTEVPTGV 512
           Y +TMF T++PKK  RIS Y  D P  G +    GV
Sbjct: 508 YDETMFSTVQPKKQ-RISHYKKDTPPSGTSYSSAGV 542


>BT023955-1|ABB36459.1|  808|Drosophila melanogaster AT31092p
           protein.
          Length = 808

 Score = 33.1 bits (72), Expect = 0.40
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 405 YVKTMFETIKPKKDLRISVYLNDKPAQGWTEVPTGV 512
           Y +TMF T++PKK  RIS Y  D P  G +    GV
Sbjct: 270 YDETMFSTVQPKKQ-RISHYKKDTPPSGTSYSSAGV 304


>AF416770-1|AAL13036.1| 1060|Drosophila melanogaster ELL protein.
          Length = 1060

 Score = 33.1 bits (72), Expect = 0.40
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 405 YVKTMFETIKPKKDLRISVYLNDKPAQGWTEVPTGV 512
           Y +TMF T++PKK  RIS Y  D P  G +    GV
Sbjct: 515 YDETMFSTVQPKKQ-RISHYKKDTPPSGTSYSSAGV 549


>AE014296-3241|AAF49098.3| 1059|Drosophila melanogaster CG32217-PA
           protein.
          Length = 1059

 Score = 33.1 bits (72), Expect = 0.40
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 405 YVKTMFETIKPKKDLRISVYLNDKPAQGWTEVPTGV 512
           Y +TMF T++PKK  RIS Y  D P  G +    GV
Sbjct: 515 YDETMFSTVQPKKQ-RISHYKKDTPPSGTSYSSAGV 549


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,610,877
Number of Sequences: 53049
Number of extensions: 610754
Number of successful extensions: 1262
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1232
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1262
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3252477558
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -