SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81479-7|CAB03943.1|  435|Caenorhabditis elegans Hypothetical pr...   142   3e-34
Z68343-3|CAA92778.1|  412|Caenorhabditis elegans Hypothetical pr...   139   2e-33
AF077542-12|AAC26293.1|  169|Caenorhabditis elegans Hypothetical...    31   0.75 
Z81576-1|CAB04643.2|  312|Caenorhabditis elegans Hypothetical pr...    29   2.3  
Z50109-8|CAA90435.1|  479|Caenorhabditis elegans Hypothetical pr...    29   2.3  
Z83120-5|CAB05588.1| 1467|Caenorhabditis elegans Hypothetical pr...    28   5.3  
Z74041-9|CAA98523.2|  801|Caenorhabditis elegans Hypothetical pr...    27   9.2  
Z74035-5|CAA98485.2|  801|Caenorhabditis elegans Hypothetical pr...    27   9.2  

>Z81479-7|CAB03943.1|  435|Caenorhabditis elegans Hypothetical
           protein C34F6.8 protein.
          Length = 435

 Score =  142 bits (343), Expect = 3e-34
 Identities = 61/84 (72%), Positives = 74/84 (88%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI+W +IK +LI PY+ +D  Y+DLGL +RD T+DQVTID+AHAIL+H+VGIKC
Sbjct: 37  DGDEMTRIIWKEIKNKLILPYLDLDIKYYDLGLEYRDETNDQVTIDAAHAILEHSVGIKC 96

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE R++EF LKKMWLSPNG
Sbjct: 97  ATITPDEARIKEFNLKKMWLSPNG 120



 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 40/53 (75%), Positives = 45/53 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVP 656
           P   IRNILGGTVFREPILC++IPR+VPGWT+PI IGRHA GDQYK  D V+P
Sbjct: 118 PNGTIRNILGGTVFREPILCKNIPRLVPGWTQPITIGRHAFGDQYKCTDLVIP 170


>Z68343-3|CAA92778.1|  412|Caenorhabditis elegans Hypothetical
           protein F59B8.2 protein.
          Length = 412

 Score =  139 bits (336), Expect = 2e-33
 Identities = 62/83 (74%), Positives = 72/83 (86%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTRI+W  IKE+LI PYV ++  +FDLG+ HRDATDDQVTID+A+A LK+NV +KCA
Sbjct: 16  GDEMTRIIWDLIKEKLILPYVDLNVHFFDLGIEHRDATDDQVTIDAANATLKYNVAVKCA 75

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE RVEEFKLKKMW SPNG
Sbjct: 76  TITPDEARVEEFKLKKMWKSPNG 98



 Score = 95.5 bits (227), Expect = 3e-20
 Identities = 41/59 (69%), Positives = 49/59 (83%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFREPI+ +++PR+V  W+KPI+IGRHAH DQYKA DFVVP  GK+E
Sbjct: 96  PNGTIRNILGGTVFREPIIVKNVPRLVNTWSKPIIIGRHAHADQYKATDFVVPGAGKLE 154


>AF077542-12|AAC26293.1|  169|Caenorhabditis elegans Hypothetical
           protein Y57G7A.9 protein.
          Length = 169

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +1

Query: 373 DDQVTIDSAHAILKHNVGIKCATITPDEQRVE 468
           +DQ   +  H I K N GI+CA + P+ Q  E
Sbjct: 29  NDQYFQEVIHRICKRNEGIRCAMLAPNAQHAE 60


>Z81576-1|CAB04643.2|  312|Caenorhabditis elegans Hypothetical
           protein R10E8.1 protein.
          Length = 312

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +1

Query: 256 DGDEMTRIM-WAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIK 432
           D D +T++  W +IK  LI  ++    L   L LP    T   +TI +   + KH +G+K
Sbjct: 172 DCDGLTKLPHWKRIKSLLIEGFIVSAPLEHFLHLPEVTITMQSITIFNLKLLKKHFLGLK 231


>Z50109-8|CAA90435.1|  479|Caenorhabditis elegans Hypothetical
           protein C09H10.3 protein.
          Length = 479

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +1

Query: 160 NKNSKVCKPVCITD*KLWNC*ESCGC*TSCREDGDEMTRIMW 285
           NK + + K  CI    L+   ESCG  T CRE  + + ++MW
Sbjct: 369 NKQTDIVK--CIARLSLFYKHESCGQCTPCREGCNWLNKMMW 408


>Z83120-5|CAB05588.1| 1467|Caenorhabditis elegans Hypothetical
           protein R06A4.8 protein.
          Length = 1467

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = -3

Query: 584 TRHNPRDTLTQYRFAEYCTAQNVTDLPFGLSHI 486
           TRHNPR   T    +    ++N  D P GL HI
Sbjct: 718 TRHNPRTHETVVVVSHTSFSKNYIDWPGGLKHI 750


>Z74041-9|CAA98523.2|  801|Caenorhabditis elegans Hypothetical
           protein F47G9.3 protein.
          Length = 801

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +1

Query: 355 PHR---DATDDQVTIDSAHAILKHNVGIKCATITPDEQR 462
           PHR      DD++ +D + ++LK    ++C ++   E+R
Sbjct: 97  PHRLLVKEWDDRILVDKSQSVLKAETKLECLSLCAQEKR 135


>Z74035-5|CAA98485.2|  801|Caenorhabditis elegans Hypothetical
           protein F47G9.3 protein.
          Length = 801

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +1

Query: 355 PHR---DATDDQVTIDSAHAILKHNVGIKCATITPDEQR 462
           PHR      DD++ +D + ++LK    ++C ++   E+R
Sbjct: 97  PHRLLVKEWDDRILVDKSQSVLKAETKLECLSLCAQEKR 135


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,401,143
Number of Sequences: 27780
Number of extensions: 316666
Number of successful extensions: 753
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 731
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 753
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1529108810
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -