SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20081
         (635 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z35601-1|CAA84667.2|  320|Caenorhabditis elegans Hypothetical pr...    95   4e-20
AB036738-1|BAB13470.1|  320|Caenorhabditis elegans neural RNA-bi...    95   4e-20
D10877-1|BAA01645.1|  346|Caenorhabditis elegans hnRNP like prot...    81   7e-16
AF038613-6|ABB51186.1|  347|Caenorhabditis elegans Human hnrnp a...    81   7e-16
AF038613-5|AAB92051.1|  346|Caenorhabditis elegans Human hnrnp a...    81   7e-16
AC084197-11|AAM44397.1|  305|Caenorhabditis elegans Homologous t...    79   2e-15
AC084197-10|AAY43984.1|  308|Caenorhabditis elegans Homologous t...    79   2e-15
AF098501-6|AAL38960.1|  315|Caenorhabditis elegans Hypothetical ...    69   4e-12
AF098501-5|AAM69104.1|  335|Caenorhabditis elegans Hypothetical ...    69   4e-12
AF098501-4|AAL38959.1|  336|Caenorhabditis elegans Hypothetical ...    69   4e-12
AF038613-8|AAL02515.2|  309|Caenorhabditis elegans Human hnrnp a...    64   1e-10
AF038613-7|ABB51185.1|  308|Caenorhabditis elegans Human hnrnp a...    64   1e-10
AF047662-1|AAC04442.1|  248|Caenorhabditis elegans Suppressor pr...    59   3e-09
Z77654-1|CAB01127.1|  114|Caenorhabditis elegans Hypothetical pr...    56   2e-08
Z68297-5|CAC70081.1|  394|Caenorhabditis elegans Hypothetical pr...    52   3e-07
AF038623-4|AAO91699.1|  177|Caenorhabditis elegans Hypothetical ...    52   5e-07
AC024791-23|AAM81102.1|  346|Caenorhabditis elegans Rnp (rrm rna...    51   8e-07
AC024791-22|AAF60676.1|  339|Caenorhabditis elegans Rnp (rrm rna...    51   8e-07
AC024791-21|AAF60666.1|  749|Caenorhabditis elegans Rnp (rrm rna...    51   8e-07
Z50110-2|CAA90446.1|  566|Caenorhabditis elegans Hypothetical pr...    50   1e-06
Z50110-1|CAA90444.1|  692|Caenorhabditis elegans Hypothetical pr...    50   1e-06
U23450-2|AAK31468.1|  302|Caenorhabditis elegans Hypothetical pr...    50   2e-06
Z81108-1|CAB03236.1|   83|Caenorhabditis elegans Hypothetical pr...    49   2e-06
Z81037-3|CAB02750.1|  205|Caenorhabditis elegans Hypothetical pr...    49   2e-06
Z92826-4|CAB07322.1|  309|Caenorhabditis elegans Hypothetical pr...    48   7e-06
U28944-7|AAN63457.1|  295|Caenorhabditis elegans Hypothetical pr...    48   7e-06
U28944-6|AAN63456.1|  305|Caenorhabditis elegans Hypothetical pr...    48   7e-06
U28944-5|AAK68191.1|  408|Caenorhabditis elegans Hypothetical pr...    48   7e-06
U28944-4|AAK68192.1|  376|Caenorhabditis elegans Hypothetical pr...    48   7e-06
AL110485-8|CAB60356.1|  434|Caenorhabditis elegans Hypothetical ...    48   7e-06
Z83230-6|CAB05746.1|  336|Caenorhabditis elegans Hypothetical pr...    47   1e-05
Z81106-3|CAB03222.1|   84|Caenorhabditis elegans Hypothetical pr...    47   1e-05
U24123-1|AAA65224.1|  646|Caenorhabditis elegans polyadenylate-b...    46   3e-05
AL032631-4|CAE54917.1|  586|Caenorhabditis elegans Hypothetical ...    46   3e-05
AL032631-3|CAE54916.1|  583|Caenorhabditis elegans Hypothetical ...    46   3e-05
AL032631-2|CAA21572.1|  646|Caenorhabditis elegans Hypothetical ...    46   3e-05
Z81108-4|CAB03237.1|   85|Caenorhabditis elegans Hypothetical pr...    45   4e-05
U21320-5|AAA62536.2|  332|Caenorhabditis elegans Rnp (rrm rna bi...    45   4e-05
Z50874-2|CAA90772.1|  357|Caenorhabditis elegans Hypothetical pr...    45   5e-05
U39997-3|AAK68389.1|  498|Caenorhabditis elegans Human daz (dele...    45   5e-05
AB025253-1|BAA88577.1|  499|Caenorhabditis elegans DAZ-1 protein.      45   5e-05
Z50044-2|CAA90354.1|  256|Caenorhabditis elegans Hypothetical pr...    44   9e-05
Z46676-8|CAB60993.2|  388|Caenorhabditis elegans Hypothetical pr...    44   9e-05
U24189-3|AAC47514.1|  398|Caenorhabditis elegans RRM-type RNA bi...    44   9e-05
AL117204-22|CAB55151.1|  331|Caenorhabditis elegans Hypothetical...    44   9e-05
AJ297847-1|CAC16732.1|  619|Caenorhabditis elegans FOG-1 protein...    44   1e-04
AJ297846-1|CAC16731.1|  619|Caenorhabditis elegans FOG-1 protein...    44   1e-04
AC024810-13|AAK68518.1|  405|Caenorhabditis elegans Feminization...    44   1e-04
AC024810-12|AAK68519.1|  619|Caenorhabditis elegans Feminization...    44   1e-04
Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical pr...    43   2e-04
Z32683-11|CAA83626.1|  142|Caenorhabditis elegans Hypothetical p...    42   3e-04
Z78536-3|CAB01717.2|  360|Caenorhabditis elegans Hypothetical pr...    42   4e-04
AF003141-14|AAM48549.1|  362|Caenorhabditis elegans Hypothetical...    41   6e-04
AF003141-13|AAK21490.1|  549|Caenorhabditis elegans Hypothetical...    41   6e-04
Z50874-3|CAA90773.1|  409|Caenorhabditis elegans Hypothetical pr...    41   9e-04
Z49910-5|CAA90120.1|  411|Caenorhabditis elegans Hypothetical pr...    41   9e-04
Z36752-6|CAA85327.1|  456|Caenorhabditis elegans Hypothetical pr...    40   0.001
U23484-11|AAC46764.2|  191|Caenorhabditis elegans Hypothetical p...    40   0.001
AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical...    40   0.001
AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical ...    40   0.001
U23484-3|AAK68298.1|  126|Caenorhabditis elegans Sr protein (spl...    40   0.001
U23484-2|AAC46767.1|  196|Caenorhabditis elegans Sr protein (spl...    40   0.001
AL132904-14|CAC35847.2|  258|Caenorhabditis elegans Hypothetical...    40   0.001
AF242767-1|AAG36874.1|  258|Caenorhabditis elegans SF2 protein.        40   0.001
U55363-5|AAA97963.1|  351|Caenorhabditis elegans Spindle orienta...    40   0.002
AF067616-7|AAM98029.1|  423|Caenorhabditis elegans Hypothetical ...    40   0.002
AF067616-6|AAC19192.1|  520|Caenorhabditis elegans Hypothetical ...    40   0.002
AF067616-5|AAU05574.1|  497|Caenorhabditis elegans Hypothetical ...    40   0.002
AB052819-1|BAC65239.1|  351|Caenorhabditis elegans PIP-1 protein.      40   0.002
Z81473-3|CAB03896.4|  514|Caenorhabditis elegans Hypothetical pr...    39   0.003
U23484-10|AAC46772.1|  197|Caenorhabditis elegans Hypothetical p...    39   0.003
AY342388-1|AAQ19851.1|  514|Caenorhabditis elegans putative RNA-...    39   0.003
AC024818-2|AAF60781.1|  302|Caenorhabditis elegans Temporarily a...    38   0.005
Z73102-13|CAA97405.1|  836|Caenorhabditis elegans Hypothetical p...    38   0.006
U80455-1|AAB37881.1|  584|Caenorhabditis elegans Elav-type rna b...    38   0.008
U79157-1|AAC26982.1|  496|Caenorhabditis elegans splicing factor...    38   0.008
U53931-1|AAA98566.1|  584|Caenorhabditis elegans elav-type ribon...    38   0.008
EF523770-1|ABS18836.1|  513|Caenorhabditis elegans ELAV-type RNA...    38   0.008
EF523769-1|ABS18835.1|  327|Caenorhabditis elegans ELAV-type RNA...    38   0.008
EF523768-1|ABS18834.1|  378|Caenorhabditis elegans ELAV-type RNA...    38   0.008
EF523767-1|ABS18833.1|  193|Caenorhabditis elegans ELAV-type RNA...    38   0.008
EF523766-1|ABS18832.1|  584|Caenorhabditis elegans ELAV-type RNA...    38   0.008
AC024875-3|AAK29989.1|  496|Caenorhabditis elegans U2af splicing...    38   0.008
AC024875-2|AAM44400.1|  471|Caenorhabditis elegans U2af splicing...    38   0.008
AC024875-1|AAL00879.1|  474|Caenorhabditis elegans U2af splicing...    38   0.008
Z97628-2|CAB10726.2|  427|Caenorhabditis elegans Hypothetical pr...    37   0.011
Z81080-5|CAB03088.2|  427|Caenorhabditis elegans Hypothetical pr...    37   0.011
Z81080-2|CAD56584.1|  358|Caenorhabditis elegans Hypothetical pr...    37   0.011
Z78419-2|CAB01702.1|  154|Caenorhabditis elegans Hypothetical pr...    36   0.024
Z69384-5|CAA93419.2|  408|Caenorhabditis elegans Hypothetical pr...    36   0.024
AF040642-5|AAN73870.2|  138|Caenorhabditis elegans Hypothetical ...    36   0.024
AF003145-3|AAB57717.1|  751|Caenorhabditis elegans Cpeb polya bi...    35   0.042
AC006833-6|AAF60950.1|  491|Caenorhabditis elegans Hypothetical ...    35   0.042
Z66521-4|CAD59160.1|  150|Caenorhabditis elegans Hypothetical pr...    35   0.056
Z66521-3|CAD59159.1|  148|Caenorhabditis elegans Hypothetical pr...    35   0.056
Z66521-2|CAA91395.1|  312|Caenorhabditis elegans Hypothetical pr...    35   0.056
Z19154-9|CAA79552.2|  559|Caenorhabditis elegans Hypothetical pr...    34   0.098
Z83119-2|CAB05579.2|  608|Caenorhabditis elegans Hypothetical pr...    33   0.13 
AL137227-1|CAB70238.2|  611|Caenorhabditis elegans Hypothetical ...    33   0.17 
U23450-1|AAK31467.2|  422|Caenorhabditis elegans Cpeb polya bind...    33   0.23 
U23172-15|AAN63408.1|  374|Caenorhabditis elegans Hypothetical p...    32   0.30 
U23172-12|ABH03526.1|  562|Caenorhabditis elegans Hypothetical p...    32   0.30 
Z36238-3|CAA85276.1|  404|Caenorhabditis elegans Hypothetical pr...    31   0.52 
DQ485531-1|ABF22491.1|  404|Caenorhabditis elegans RNA-binding p...    31   0.52 
Z75552-9|CAA99945.2|  705|Caenorhabditis elegans Hypothetical pr...    31   0.69 
Z75551-6|CAA99937.2|  705|Caenorhabditis elegans Hypothetical pr...    31   0.69 
AF039713-10|AAB96721.1|  691|Caenorhabditis elegans Hypothetical...    31   0.69 
L07144-4|AAK21440.2|  187|Caenorhabditis elegans Hypothetical pr...    31   0.91 
Z35663-4|CAA84724.1|  307|Caenorhabditis elegans Hypothetical pr...    30   1.2  
U41007-10|AAL32214.1|  118|Caenorhabditis elegans Sr protein (sp...    30   1.2  
U41007-9|AAL32213.1|  153|Caenorhabditis elegans Sr protein (spl...    30   1.2  
U41007-8|AAA82270.1|  179|Caenorhabditis elegans Sr protein (spl...    30   1.2  
Z99279-4|CAB16494.1|  121|Caenorhabditis elegans Hypothetical pr...    30   1.6  
Z81120-1|CAB03342.1|  207|Caenorhabditis elegans Hypothetical pr...    30   1.6  
U23172-14|AAL02495.1|  165|Caenorhabditis elegans Hypothetical p...    30   1.6  
U14635-1|AAC46657.2|  448|Caenorhabditis elegans Hypothetical pr...    30   1.6  
L07144-9|AAK21441.1|  737|Caenorhabditis elegans Hypothetical pr...    30   1.6  
Z68160-1|CAA92294.2|  489|Caenorhabditis elegans Hypothetical pr...    29   2.1  
U28944-8|AAK68193.1|  103|Caenorhabditis elegans Hypothetical pr...    29   2.1  
Z99277-2|CAB16487.1|  557|Caenorhabditis elegans Hypothetical pr...    29   2.8  
Z68879-10|CAA93082.2|  473|Caenorhabditis elegans Hypothetical p...    29   2.8  
Z66521-8|CAA91394.1|  281|Caenorhabditis elegans Hypothetical pr...    29   2.8  
AC024791-14|AAF60658.1|  767|Caenorhabditis elegans P300/cbp ass...    29   2.8  
Z36238-4|CAD82915.1|  286|Caenorhabditis elegans Hypothetical pr...    28   4.9  
Z37983-4|CAA86057.1|  803|Caenorhabditis elegans Hypothetical pr...    28   6.4  
AF047659-10|AAC04430.1|  798|Caenorhabditis elegans Hypothetical...    28   6.4  
AL132948-22|CAD31825.2| 1408|Caenorhabditis elegans Hypothetical...    27   8.5  
AF067619-1|AAC17568.2|  368|Caenorhabditis elegans Hypothetical ...    27   8.5  

>Z35601-1|CAA84667.2|  320|Caenorhabditis elegans Hypothetical
           protein R10E9.1 protein.
          Length = 320

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT + LRD+FG +GE+    V  DP T R+RGF FI F  P S+DKV+  
Sbjct: 46  KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN 105

Query: 190 GEHTINNKKVDPKKA--KARHGKILSEDSAV 276
            EH ++ KK+DPK A  K    K++++   V
Sbjct: 106 REHELDGKKIDPKVAFPKRTQAKLVTKTKKV 136



 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 31/79 (39%), Positives = 48/79 (60%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+F+GGLS  +T ++++ +F  YG++E   +  D  T R RGF F+ F + E  DKV  
Sbjct: 134 KKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCE 193

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H IN K V+ KKA+ +
Sbjct: 194 IHFHEINGKMVECKKAQPK 212



 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS+  + ++++ +F  +G + +  + FDK   + +GF F+TF+S++V + + +   
Sbjct: 137 FIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHF 196

Query: 435 RTIGGKEVDVKRATPK 482
             I GK V+ K+A PK
Sbjct: 197 HEINGKMVECKKAQPK 212



 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 26/76 (34%), Positives = 43/76 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + + + +R++F  FG + E  +  D    + +GF FITF     V+ +L   +
Sbjct: 48  FIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNRE 107

Query: 435 RTIGGKEVDVKRATPK 482
             + GK++D K A PK
Sbjct: 108 HELDGKKIDPKVAFPK 123


>AB036738-1|BAB13470.1|  320|Caenorhabditis elegans neural
           RNA-binding protein MSI-1 protein.
          Length = 320

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT + LRD+FG +GE+    V  DP T R+RGF FI F  P S+DKV+  
Sbjct: 46  KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN 105

Query: 190 GEHTINNKKVDPKKA--KARHGKILSEDSAV 276
            EH ++ KK+DPK A  K    K++++   V
Sbjct: 106 REHELDGKKIDPKVAFPKRTQAKLVTKTKKV 136



 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 31/79 (39%), Positives = 48/79 (60%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+F+GGLS  +T ++++ +F  YG++E   +  D  T R RGF F+ F + E  DKV  
Sbjct: 134 KKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCE 193

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H IN K V+ KKA+ +
Sbjct: 194 IHFHEINGKMVECKKAQPK 212



 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS+  + ++++ +F  +G + +  + FDK   + +GF F+TF+S++V + + +   
Sbjct: 137 FIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHF 196

Query: 435 RTIGGKEVDVKRATPK 482
             I GK V+ K+A PK
Sbjct: 197 HEINGKMVECKKAQPK 212



 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 26/76 (34%), Positives = 43/76 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + + + +R++F  FG + E  +  D    + +GF FITF     V+ +L   +
Sbjct: 48  FIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNRE 107

Query: 435 RTIGGKEVDVKRATPK 482
             + GK++D K A PK
Sbjct: 108 HELDGKKIDPKVAFPK 123


>D10877-1|BAA01645.1|  346|Caenorhabditis elegans hnRNP like protein
           protein.
          Length = 346

 Score = 81.0 bits (191), Expect = 7e-16
 Identities = 40/96 (41%), Positives = 53/96 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+  TTD  +R+ +  +GEI  I V  DP T RSRGF F+ F     +D  M  
Sbjct: 24  KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQ 83

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
             H I+ K VDPK+A  R  K  SE +    ++  S
Sbjct: 84  RPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVS 119



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 33/78 (42%), Positives = 48/78 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+S  +DD +R F+S+FG I ++ +  D T  + +GF F+TF  +  V+  +K   
Sbjct: 26  FVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRP 85

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK VD KRA P+ D
Sbjct: 86  HIIDGKTVDPKRAVPRDD 103



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 27/94 (28%), Positives = 48/94 (51%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++L+V G+  + T+  L ++F  YG +    +  D  T + RGF F+ F   +S+D+ + 
Sbjct: 114 KRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVL 173

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQM 288
              H +N  + D +K        LS+D   K+QM
Sbjct: 174 QKSHMVNGHRCDVRKG-------LSKDEMSKAQM 200



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 19/78 (24%), Positives = 42/78 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V G+  + ++D +  +F+++GT+ + E+  DK   + +GF F+TF+    V+  +    
Sbjct: 117 YVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKS 176

Query: 435 RTIGGKEVDVKRATPKPD 488
             + G   DV++   K +
Sbjct: 177 HMVNGHRCDVRKGLSKDE 194


>AF038613-6|ABB51186.1|  347|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform d protein.
          Length = 347

 Score = 81.0 bits (191), Expect = 7e-16
 Identities = 40/96 (41%), Positives = 53/96 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+  TTD  +R+ +  +GEI  I V  DP T RSRGF F+ F     +D  M  
Sbjct: 24  KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQ 83

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
             H I+ K VDPK+A  R  K  SE +    ++  S
Sbjct: 84  RPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVS 119



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 33/78 (42%), Positives = 48/78 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+S  +DD +R F+S+FG I ++ +  D T  + +GF F+TF  +  V+  +K   
Sbjct: 26  FVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRP 85

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK VD KRA P+ D
Sbjct: 86  HIIDGKTVDPKRAVPRDD 103



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 27/94 (28%), Positives = 48/94 (51%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++L+V G+  + T+  L ++F  YG +    +  D  T + RGF F+ F   +S+D+ + 
Sbjct: 114 KRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVL 173

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQM 288
              H +N  + D +K        LS+D   K+QM
Sbjct: 174 QKSHMVNGHRCDVRKG-------LSKDEMSKAQM 200



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 19/78 (24%), Positives = 42/78 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V G+  + ++D +  +F+++GT+ + E+  DK   + +GF F+TF+    V+  +    
Sbjct: 117 YVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKS 176

Query: 435 RTIGGKEVDVKRATPKPD 488
             + G   DV++   K +
Sbjct: 177 HMVNGHRCDVRKGLSKDE 194


>AF038613-5|AAB92051.1|  346|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform a protein.
          Length = 346

 Score = 81.0 bits (191), Expect = 7e-16
 Identities = 40/96 (41%), Positives = 53/96 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+  TTD  +R+ +  +GEI  I V  DP T RSRGF F+ F     +D  M  
Sbjct: 24  KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQ 83

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
             H I+ K VDPK+A  R  K  SE +    ++  S
Sbjct: 84  RPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVS 119



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 33/78 (42%), Positives = 48/78 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+S  +DD +R F+S+FG I ++ +  D T  + +GF F+TF  +  V+  +K   
Sbjct: 26  FVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRP 85

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK VD KRA P+ D
Sbjct: 86  HIIDGKTVDPKRAVPRDD 103



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 27/94 (28%), Positives = 48/94 (51%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++L+V G+  + T+  L ++F  YG +    +  D  T + RGF F+ F   +S+D+ + 
Sbjct: 114 KRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVL 173

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQM 288
              H +N  + D +K        LS+D   K+QM
Sbjct: 174 QKSHMVNGHRCDVRKG-------LSKDEMSKAQM 200



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 19/78 (24%), Positives = 42/78 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V G+  + ++D +  +F+++GT+ + E+  DK   + +GF F+TF+    V+  +    
Sbjct: 117 YVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKS 176

Query: 435 RTIGGKEVDVKRATPKPD 488
             + G   DV++   K +
Sbjct: 177 HMVNGHRCDVRKGLSKDE 194


>AC084197-11|AAM44397.1|  305|Caenorhabditis elegans Homologous to
           drosophila sqd (squid)protein protein 1, isoform a
           protein.
          Length = 305

 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 38/82 (46%), Positives = 49/82 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S E  +++L  HF  YGE+    VK D   GRSRGFAF+ F   E     +A
Sbjct: 29  KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALA 88

Query: 187 AGEHTINNKKVDPKKAKARHGK 252
           A E TI  K V+ K AK+R  K
Sbjct: 89  AREQTIKGKSVEVKPAKSRENK 110



 Score = 75.8 bits (178), Expect = 2e-14
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL S+ S+ ++R+ F +FG + ++E PFDK    R+ F FI FE E+  +      K
Sbjct: 113 FVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTK 172

Query: 435 RTIGGKEVDVKRATPKPDG-PGA 500
           +T G +E DVK+A P+    PGA
Sbjct: 173 QTFGTRECDVKKAVPQGKRFPGA 195



 Score = 64.9 bits (151), Expect = 5e-11
 Identities = 30/77 (38%), Positives = 47/77 (61%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++K+FVGGL  + ++++LR HF  +G+++ I    D  T   R FAFIVF+  ES DK  
Sbjct: 109 NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKAS 168

Query: 184 AAGEHTINNKKVDPKKA 234
           +  + T   ++ D KKA
Sbjct: 169 SQTKQTFGTRECDVKKA 185



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/73 (31%), Positives = 48/73 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+S E++++++ + F+++G + + ++ +D+T  + +GF F+ F + +     L   +
Sbjct: 32  FVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAARE 91

Query: 435 RTIGGKEVDVKRA 473
           +TI GK V+VK A
Sbjct: 92  QTIKGKSVEVKPA 104


>AC084197-10|AAY43984.1|  308|Caenorhabditis elegans Homologous to
           drosophila sqd (squid)protein protein 1, isoform b
           protein.
          Length = 308

 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 38/82 (46%), Positives = 49/82 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S E  +++L  HF  YGE+    VK D   GRSRGFAF+ F   E     +A
Sbjct: 29  KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALA 88

Query: 187 AGEHTINNKKVDPKKAKARHGK 252
           A E TI  K V+ K AK+R  K
Sbjct: 89  AREQTIKGKSVEVKPAKSRENK 110



 Score = 75.8 bits (178), Expect = 2e-14
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL S+ S+ ++R+ F +FG + ++E PFDK    R+ F FI FE E+  +      K
Sbjct: 113 FVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTK 172

Query: 435 RTIGGKEVDVKRATPKPDG-PGA 500
           +T G +E DVK+A P+    PGA
Sbjct: 173 QTFGTRECDVKKAVPQGKRFPGA 195



 Score = 64.9 bits (151), Expect = 5e-11
 Identities = 30/77 (38%), Positives = 47/77 (61%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++K+FVGGL  + ++++LR HF  +G+++ I    D  T   R FAFIVF+  ES DK  
Sbjct: 109 NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKAS 168

Query: 184 AAGEHTINNKKVDPKKA 234
           +  + T   ++ D KKA
Sbjct: 169 SQTKQTFGTRECDVKKA 185



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/73 (31%), Positives = 48/73 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+S E++++++ + F+++G + + ++ +D+T  + +GF F+ F + +     L   +
Sbjct: 32  FVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAARE 91

Query: 435 RTIGGKEVDVKRA 473
           +TI GK V+VK A
Sbjct: 92  QTIKGKSVEVKPA 104


>AF098501-6|AAL38960.1|  315|Caenorhabditis elegans Hypothetical
           protein H28G03.1b protein.
          Length = 315

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS +TTD++L ++F  +G +    V  DPNT  SRGF F+ F +  S +  M  
Sbjct: 50  KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMND 109

Query: 190 GEHTINNKKVDPKKAKAR 243
             H +  K VD K+A  R
Sbjct: 110 RPHKLGGKTVDSKRAIPR 127



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/76 (34%), Positives = 44/76 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + +D+++ N+FS++G +++  +  D      +GF F+TF S       +    
Sbjct: 52  FIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRP 111

Query: 435 RTIGGKEVDVKRATPK 482
             +GGK VD KRA P+
Sbjct: 112 HKLGGKTVDSKRAIPR 127


>AF098501-5|AAM69104.1|  335|Caenorhabditis elegans Hypothetical
           protein H28G03.1c protein.
          Length = 335

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS +TTD++L ++F  +G +    V  DPNT  SRGF F+ F +  S +  M  
Sbjct: 70  KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMND 129

Query: 190 GEHTINNKKVDPKKAKAR 243
             H +  K VD K+A  R
Sbjct: 130 RPHKLGGKTVDSKRAIPR 147



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/76 (34%), Positives = 44/76 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + +D+++ N+FS++G +++  +  D      +GF F+TF S       +    
Sbjct: 72  FIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRP 131

Query: 435 RTIGGKEVDVKRATPK 482
             +GGK VD KRA P+
Sbjct: 132 HKLGGKTVDSKRAIPR 147


>AF098501-4|AAL38959.1|  336|Caenorhabditis elegans Hypothetical
           protein H28G03.1a protein.
          Length = 336

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS +TTD++L ++F  +G +    V  DPNT  SRGF F+ F +  S +  M  
Sbjct: 71  KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMND 130

Query: 190 GEHTINNKKVDPKKAKAR 243
             H +  K VD K+A  R
Sbjct: 131 RPHKLGGKTVDSKRAIPR 148



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/76 (34%), Positives = 44/76 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + +D+++ N+FS++G +++  +  D      +GF F+TF S       +    
Sbjct: 73  FIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRP 132

Query: 435 RTIGGKEVDVKRATPK 482
             +GGK VD KRA P+
Sbjct: 133 HKLGGKTVDSKRAIPR 148


>AF038613-8|AAL02515.2|  309|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform b protein.
          Length = 309

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 31/81 (38%), Positives = 42/81 (51%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 234
           +R+ +  +GEI  I V  DP T RSRGF F+ F     +D  M    H I+ K VDPK+A
Sbjct: 1   MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRA 60

Query: 235 KARHGKILSEDSAVKSQMMKS 297
             R  K  SE +    ++  S
Sbjct: 61  VPRDDKNRSESNVSTKRLYVS 81



 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 25/65 (38%), Positives = 38/65 (58%)
 Frame = +3

Query: 294 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
           +R F+S+FG I ++ +  D T  + +GF F+TF  +  V+  +K     I GK VD KRA
Sbjct: 1   MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRA 60

Query: 474 TPKPD 488
            P+ D
Sbjct: 61  VPRDD 65



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 27/94 (28%), Positives = 48/94 (51%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++L+V G+  + T+  L ++F  YG +    +  D  T + RGF F+ F   +S+D+ + 
Sbjct: 76  KRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVL 135

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQM 288
              H +N  + D +K        LS+D   K+QM
Sbjct: 136 QKSHMVNGHRCDVRKG-------LSKDEMSKAQM 162



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 19/78 (24%), Positives = 42/78 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V G+  + ++D +  +F+++GT+ + E+  DK   + +GF F+TF+    V+  +    
Sbjct: 79  YVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKS 138

Query: 435 RTIGGKEVDVKRATPKPD 488
             + G   DV++   K +
Sbjct: 139 HMVNGHRCDVRKGLSKDE 156


>AF038613-7|ABB51185.1|  308|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform c protein.
          Length = 308

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 31/81 (38%), Positives = 42/81 (51%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 234
           +R+ +  +GEI  I V  DP T RSRGF F+ F     +D  M    H I+ K VDPK+A
Sbjct: 1   MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRA 60

Query: 235 KARHGKILSEDSAVKSQMMKS 297
             R  K  SE +    ++  S
Sbjct: 61  VPRDDKNRSESNVSTKRLYVS 81



 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 25/65 (38%), Positives = 38/65 (58%)
 Frame = +3

Query: 294 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
           +R F+S+FG I ++ +  D T  + +GF F+TF  +  V+  +K     I GK VD KRA
Sbjct: 1   MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRA 60

Query: 474 TPKPD 488
            P+ D
Sbjct: 61  VPRDD 65



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 27/94 (28%), Positives = 48/94 (51%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++L+V G+  + T+  L ++F  YG +    +  D  T + RGF F+ F   +S+D+ + 
Sbjct: 76  KRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVL 135

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQM 288
              H +N  + D +K        LS+D   K+QM
Sbjct: 136 QKSHMVNGHRCDVRKG-------LSKDEMSKAQM 162



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 19/78 (24%), Positives = 42/78 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V G+  + ++D +  +F+++GT+ + E+  DK   + +GF F+TF+    V+  +    
Sbjct: 79  YVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKS 138

Query: 435 RTIGGKEVDVKRATPKPD 488
             + G   DV++   K +
Sbjct: 139 HMVNGHRCDVRKGLSKDE 156


>AF047662-1|AAC04442.1|  248|Caenorhabditis elegans Suppressor
           protein 12 protein.
          Length = 248

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + T+DK L ++F  +G+IE   V TD NT +SRG+ F+  K   S ++    
Sbjct: 36  KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD 95

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 96  PNPIIDGRKAN 106



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    SD  +  +F +FG I E  +  D+   + +G+ F+T +         K P 
Sbjct: 38  FVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN 97

Query: 435 RTIGGKEVDVKRA 473
             I G++ +V  A
Sbjct: 98  PIIDGRKANVNLA 110


>Z77654-1|CAB01127.1|  114|Caenorhabditis elegans Hypothetical
           protein C50B8.1 protein.
          Length = 114

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 24/72 (33%), Positives = 41/72 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + +++  + W T   +L  +F  YG I+S+N+  DP+TG  RGFA I F + +  +K + 
Sbjct: 25  QTVYLTHVKWVTGKSQLEHYFKRYGSIQSVNMFYDPDTGLHRGFASITFDSKDGANKAIE 84

Query: 187 AGEHTINNKKVD 222
              H I+  +VD
Sbjct: 85  QRPHVIDGDRVD 96



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 25/89 (28%), Positives = 43/89 (48%)
 Frame = +3

Query: 213 ESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           E+RPK    T +   V  ++ +    ++ ++F  +G+I  V M +D      +GF  ITF
Sbjct: 17  EARPKNTGQTVYLTHVKWVTGK---SQLEHYFKRYGSIQSVNMFYDPDTGLHRGFASITF 73

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATP 479
           +S+   N  ++     I G  VDV+   P
Sbjct: 74  DSKDGANKAIEQRPHVIDGDRVDVEPYIP 102


>Z68297-5|CAC70081.1|  394|Caenorhabditis elegans Hypothetical
           protein F11A10.7 protein.
          Length = 394

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAY-GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +FVG L +E T+  L   F A  G +E++ +  D +TG+ +GFAF+ FK   S+   +A 
Sbjct: 248 IFVGNLPFEITEDALITFFSAQIGPVEAVRIVRDKDTGKGKGFAFVNFKQDSSVS--LAL 305

Query: 190 GEHTINNKKVDPKKAKA-RHGKILSEDSAVK-SQMMKSETSSVNLELS*KWRCPLTKQRT 363
              TI  +K D +  K  + G +    +A K +   K   + +  +L  K++    K+RT
Sbjct: 306 SMETIKMEKRDLRITKVMKKGHLTKIQTAKKRTSHGKKNQNEITGKLH-KFKFSTKKERT 364

Query: 364 KER 372
            E+
Sbjct: 365 TEQ 367



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           FVG +   +++  +R  FS+FGTI  V M
Sbjct: 146 FVGNMPLTMNEKSVRRIFSDFGTISSVRM 174


>AF038623-4|AAO91699.1|  177|Caenorhabditis elegans Hypothetical
           protein T08B6.5 protein.
          Length = 177

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + W++T  E+ +HF   G++  + +  D  TG  + FAF+ F+  ES+   +   
Sbjct: 48  VYVGNVDWKSTVSEIEEHFAVCGKVARVTIPKDKFTGYQKNFAFVEFQKLESVQLALVLS 107

Query: 193 EHTINNKKV 219
                N+K+
Sbjct: 108 GTMFRNRKI 116


>AC024791-23|AAM81102.1|  346|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform c protein.
          Length = 346

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 21/53 (39%), Positives = 35/53 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG +S+E  +  LR  F  +G I+SIN+  DP TG  + FAF+ ++ PE+
Sbjct: 103 RIYVGSISFEIREDMLRRAFDPFGPIKSINMSWDPATGHHKTFAFVEYEVPEA 155



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRS-RGFAFIVFKAPESIDK 177
           ++ +++V  +  + ++ +L+  F A+GEI    +   P TGR  RGF ++ F    S  +
Sbjct: 205 KYFRVYVSSVHPDLSETDLKSVFEAFGEIVKCQLARAP-TGRGHRGFGYLEFNNLTSQSE 263

Query: 178 VMA 186
            +A
Sbjct: 264 AIA 266


>AC024791-22|AAF60676.1|  339|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform a protein.
          Length = 339

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 21/53 (39%), Positives = 35/53 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG +S+E  +  LR  F  +G I+SIN+  DP TG  + FAF+ ++ PE+
Sbjct: 103 RIYVGSISFEIREDMLRRAFDPFGPIKSINMSWDPATGHHKTFAFVEYEVPEA 155



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRS-RGFAFIVFKAPESIDK 177
           ++ +++V  +  + ++ +L+  F A+GEI    +   P TGR  RGF ++ F    S  +
Sbjct: 205 KYFRVYVSSVHPDLSETDLKSVFEAFGEIVKCQLARAP-TGRGHRGFGYLEFNNLTSQSE 263

Query: 178 VMA 186
            +A
Sbjct: 264 AIA 266


>AC024791-21|AAF60666.1|  749|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform b protein.
          Length = 749

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 21/53 (39%), Positives = 35/53 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG +S+E  +  LR  F  +G I+SIN+  DP TG  + FAF+ ++ PE+
Sbjct: 103 RIYVGSISFEIREDMLRRAFDPFGPIKSINMSWDPATGHHKTFAFVEYEVPEA 155



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRS-RGFAFIVFKAPESIDK 177
           ++ +++V  +  + ++ +L+  F A+GEI    +   P TGR  RGF ++ F    S  +
Sbjct: 205 KYFRVYVSSVHPDLSETDLKSVFEAFGEIVKCQLARAP-TGRGHRGFGYLEFNNLTSQSE 263

Query: 178 VMA 186
            +A
Sbjct: 264 AIA 266


>Z50110-2|CAA90446.1|  566|Caenorhabditis elegans Hypothetical
           protein F18H3.3b protein.
          Length = 566

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+V  +  +  D  LRDHF ++G I S  V  D N GRS+GF F+ F+ PE
Sbjct: 345 LYVKNIEEDLNDDGLRDHFSSFGTITSAKVMVDEN-GRSKGFGFVCFEKPE 394



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           +V  +  +++DD +R+ FS FGTI   ++  D+   + KGF F+ FE  E+    +    
Sbjct: 346 YVKNIEEDLNDDGLRDHFSSFGTITSAKVMVDE-NGRSKGFGFVCFEKPEEATAAVTDMN 404

Query: 432 KRTIGGKEVDVKRATPKPD 488
            + IG K + V  A  K D
Sbjct: 405 SKMIGAKPLYVALAQRKED 423



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 15/57 (26%), Positives = 30/57 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L++G L  + ++  L + F   G + SI V  D  +  S G+A++ F+ P   ++ +
Sbjct: 59  LYIGDLHPDVSEAMLFEKFSMAGPVLSIRVCRDNTSRLSLGYAYVNFQQPADAERAL 115


>Z50110-1|CAA90444.1|  692|Caenorhabditis elegans Hypothetical
           protein F18H3.3a protein.
          Length = 692

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+V  +  +  D  LRDHF ++G I S  V  D N GRS+GF F+ F+ PE
Sbjct: 345 LYVKNIEEDLNDDGLRDHFSSFGTITSAKVMVDEN-GRSKGFGFVCFEKPE 394



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           +V  +  +++DD +R+ FS FGTI   ++  D+   + KGF F+ FE  E+    +    
Sbjct: 346 YVKNIEEDLNDDGLRDHFSSFGTITSAKVMVDE-NGRSKGFGFVCFEKPEEATAAVTDMN 404

Query: 432 KRTIGGKEVDVKRATPKPD 488
            + IG K + V  A  K D
Sbjct: 405 SKMIGAKPLYVALAQRKED 423



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 15/57 (26%), Positives = 30/57 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L++G L  + ++  L + F   G + SI V  D  +  S G+A++ F+ P   ++ +
Sbjct: 59  LYIGDLHPDVSEAMLFEKFSMAGPVLSIRVCRDNTSRLSLGYAYVNFQQPADAERAL 115


>U23450-2|AAK31468.1|  302|Caenorhabditis elegans Hypothetical
           protein C30B5.4 protein.
          Length = 302

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 36/52 (69%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++GGLS+  ++ ++   F  YGE+ +IN+  D +TG+S+GFAF+ +K   S
Sbjct: 40  IYIGGLSYALSEGDVIAVFSQYGEVMNINLIRDKDTGKSKGFAFLCYKDQRS 91



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 14/50 (28%), Positives = 32/50 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           ++GGLS  +S+ ++   FS++G ++ + +  DK   + KGF F+ ++ ++
Sbjct: 41  YIGGLSYALSEGDVIAVFSQYGEVMNINLIRDKDTGKSKGFAFLCYKDQR 90


>Z81108-1|CAB03236.1|   83|Caenorhabditis elegans Hypothetical
           protein R09B3.2 protein.
          Length = 83

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 21/57 (36%), Positives = 35/57 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++VG   ++TT++EL + F + G+I ++ +  D  TGR RGFAFI F    S  + +
Sbjct: 7   VYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAV 63



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           +VG    + +++E+ NFFS  G I  V +  D+   + +GF FI F  E
Sbjct: 8   YVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEE 56


>Z81037-3|CAB02750.1|  205|Caenorhabditis elegans Hypothetical
           protein C17E4.5 protein.
          Length = 205

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + ++VG + +  T +E+  HF   G +  + ++ D  +G  +GFA++ F   E +   +A
Sbjct: 78  KSVYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTEKEGMQNALA 137

Query: 187 AGEHTINNK--KVDPKK 231
             +  +  +  KVDPK+
Sbjct: 138 MTDSLLRGRQIKVDPKR 154



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    + +EI   F   G++  V +  D+     KGF ++ F  ++ + + L    
Sbjct: 81  YVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTEKEGMQNALAMTD 140

Query: 435 RTIGGKEVDV-KRATPKP 485
             + G+++ V  + T KP
Sbjct: 141 SLLRGRQIKVDPKRTNKP 158


>Z92826-4|CAB07322.1|  309|Caenorhabditis elegans Hypothetical
           protein C18D11.4 protein.
          Length = 309

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 25/51 (49%), Positives = 31/51 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L V  LS  TT+K+LRD FG +GEI   ++  D  +G SRGF FI F   E
Sbjct: 78  LGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIE 128



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           V  LSS  ++ ++R+ F EFG I + ++ +D+     +GF FI F
Sbjct: 80  VFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYF 124


>U28944-7|AAN63457.1|  295|Caenorhabditis elegans Hypothetical
           protein C18A3.5f protein.
          Length = 295

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 20/61 (32%), Positives = 36/61 (59%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH  +FVG LS E  +++LR+ F  +G++    V  D NT +S+G+ F+ +   E  ++ 
Sbjct: 20  RHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 79

Query: 181 M 183
           +
Sbjct: 80  I 80



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG LSSE+ + ++R  F  FG + + ++  D    + KG+ F+++ + E+    + +  
Sbjct: 25  FVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMN 84

Query: 432 KRTIGGKEVDVKRATPKP 485
            + +G + +    AT KP
Sbjct: 85  GQWLGRRTIRTNWATRKP 102



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           +VG ++S +++DEIR  F+ FG I EV +       + +G+ F+ F++ +     +++  
Sbjct: 131 YVGNIAS-LTEDEIRQGFASFGRITEVRI------FKMQGYAFVKFDNKDAAAKAIVQMN 183

Query: 432 KRTIGGKEV 458
            + +GG+ V
Sbjct: 184 NQDVGGQLV 192


>U28944-6|AAN63456.1|  305|Caenorhabditis elegans Hypothetical
           protein C18A3.5e protein.
          Length = 305

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 20/61 (32%), Positives = 36/61 (59%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH  +FVG LS E  +++LR+ F  +G++    V  D NT +S+G+ F+ +   E  ++ 
Sbjct: 30  RHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 89

Query: 181 M 183
           +
Sbjct: 90  I 90



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG LSSE+ + ++R  F  FG + + ++  D    + KG+ F+++ + E+    + +  
Sbjct: 35  FVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMN 94

Query: 432 KRTIGGKEVDVKRATPKP 485
            + +G + +    AT KP
Sbjct: 95  GQWLGRRTIRTNWATRKP 112



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           +VG ++S +++DEIR  F+ FG I EV +       + +G+ F+ F++ +     +++  
Sbjct: 141 YVGNIAS-LTEDEIRQGFASFGRITEVRI------FKMQGYAFVKFDNKDAAAKAIVQMN 193

Query: 432 KRTIGGKEV 458
            + +GG+ V
Sbjct: 194 NQDVGGQLV 202


>U28944-5|AAK68191.1|  408|Caenorhabditis elegans Hypothetical
           protein C18A3.5a protein.
          Length = 408

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 20/61 (32%), Positives = 36/61 (59%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH  +FVG LS E  +++LR+ F  +G++    V  D NT +S+G+ F+ +   E  ++ 
Sbjct: 133 RHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 192

Query: 181 M 183
           +
Sbjct: 193 I 193



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG LSSE+ + ++R  F  FG + + ++  D    + KG+ F+++ + E+    + +  
Sbjct: 138 FVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMN 197

Query: 432 KRTIGGKEVDVKRATPKP 485
            + +G + +    AT KP
Sbjct: 198 GQWLGRRTIRTNWATRKP 215



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           +VG ++S +++DEIR  F+ FG I EV +       + +G+ F+ F++ +     +++  
Sbjct: 244 YVGNIAS-LTEDEIRQGFASFGRITEVRI------FKMQGYAFVKFDNKDAAAKAIVQMN 296

Query: 432 KRTIGGKEV 458
            + +GG+ V
Sbjct: 297 NQDVGGQLV 305


>U28944-4|AAK68192.1|  376|Caenorhabditis elegans Hypothetical
           protein C18A3.5b protein.
          Length = 376

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 20/61 (32%), Positives = 36/61 (59%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH  +FVG LS E  +++LR+ F  +G++    V  D NT +S+G+ F+ +   E  ++ 
Sbjct: 101 RHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERA 160

Query: 181 M 183
           +
Sbjct: 161 I 161



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG LSSE+ + ++R  F  FG + + ++  D    + KG+ F+++ + E+    + +  
Sbjct: 106 FVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMN 165

Query: 432 KRTIGGKEVDVKRATPKP 485
            + +G + +    AT KP
Sbjct: 166 GQWLGRRTIRTNWATRKP 183



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           +VG ++S +++DEIR  F+ FG I EV +       + +G+ F+ F++ +     +++  
Sbjct: 212 YVGNIAS-LTEDEIRQGFASFGRITEVRI------FKMQGYAFVKFDNKDAAAKAIVQMN 264

Query: 432 KRTIGGKEV 458
            + +GG+ V
Sbjct: 265 NQDVGGQLV 273



 Score = 31.1 bits (67), Expect = 0.69
 Identities = 11/35 (31%), Positives = 23/35 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK 359
           +VG L S +++D I   F++ G++ + ++ FD+ K
Sbjct: 49  YVGNLDSTVTEDFIATLFNQIGSVTKTKVIFDEMK 83


>AL110485-8|CAB60356.1|  434|Caenorhabditis elegans Hypothetical
           protein Y46G5A.13 protein.
          Length = 434

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 1/96 (1%)
 Frame = +3

Query: 213 ESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           E+R K   S  +  FVG L SEI   ++R  F +FG + E ++  D   N+ KG+ F+++
Sbjct: 121 ENRSKPETSRHFHVFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSY 180

Query: 393 -ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
              E     + +     +G + +    AT KPD  G
Sbjct: 181 PRREDAERAIDEMNGAWLGRRTIRTNWATRKPDEDG 216



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH  +FVG L  E    +LR+ F  +GE+    +  D NT + +G+ F+ +   E  ++ 
Sbjct: 130 RHFHVFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERA 189

Query: 181 M 183
           +
Sbjct: 190 I 190



 Score = 31.1 bits (67), Expect = 0.69
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           +VG +++ + +DEIR  F  FG I EV         + +G+ F+ FE+ E     +++  
Sbjct: 259 YVGNIAN-LGEDEIRRAFDRFGPINEVR------TFKIQGYAFVKFETKESAARAIVQMN 311

Query: 432 KRTIGGKEV 458
              IGG+ V
Sbjct: 312 NADIGGQIV 320


>Z83230-6|CAB05746.1|  336|Caenorhabditis elegans Hypothetical
           protein F56A8.6 protein.
          Length = 336

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FVG +S ++S+D IR+ FS+ G +L ++M  D+   + KG+ FI F   Q
Sbjct: 21  FVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQ 70



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           +FVG +S++ ++  +R  F   G + SI +  D  TG+ +G+ FI F
Sbjct: 20  VFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEF 66


>Z81106-3|CAB03222.1|   84|Caenorhabditis elegans Hypothetical
           protein R06C1.4 protein.
          Length = 84

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 17/47 (36%), Positives = 32/47 (68%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           ++VG + ++ T++E+ ++F A G + ++ +  D  TGR RGFAF+ F
Sbjct: 8   VYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEF 54



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 14/49 (28%), Positives = 29/49 (59%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           +VG +  + +++EI N+F+  G +  V + +D+   + +GF F+ F  E
Sbjct: 9   YVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEE 57


>U24123-1|AAA65224.1|  646|Caenorhabditis elegans
           polyadenylate-binding protein protein.
          Length = 646

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/51 (45%), Positives = 29/51 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+V  L     D  L+  F +YG I S  V TD N GRS+GF F+ F+ PE
Sbjct: 319 LYVKNLDETVDDDGLKKQFESYGNITSAKVMTDEN-GRSKGFGFVCFEKPE 368



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L + F A G + SI V  D  T  S G+A++ F+ P   ++ M
Sbjct: 34  LYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAM 90



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 6/90 (6%)
 Frame = +1

Query: 67  FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVD-----PK 228
           F  +G I S  V T    G+S+GF F+ F  PE  +  V A  + TI    +       +
Sbjct: 233 FAKFGNITSCEVMTVE--GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQ 290

Query: 229 KAKARHGKILSEDSAVKSQMMKSETSSVNL 318
           K   RH ++  +    K++ M+ +   VNL
Sbjct: 291 KKSERHAELKKKHEQHKAERMQ-KYQGVNL 319


>AL032631-4|CAE54917.1|  586|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2c protein.
          Length = 586

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/51 (45%), Positives = 29/51 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+V  L     D  L+  F +YG I S  V TD N GRS+GF F+ F+ PE
Sbjct: 259 LYVKNLDETVDDDGLKKQFESYGNITSAKVMTDEN-GRSKGFGFVCFEKPE 308



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L + F A G + SI V  D  T  S G+A++ F+ P   ++ M
Sbjct: 34  LYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAM 90



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 6/90 (6%)
 Frame = +1

Query: 67  FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVD-----PK 228
           F  +G I S  V T    G+S+GF F+ F  PE  +  V A  + TI    +       +
Sbjct: 173 FAKFGNITSCEVMTVE--GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQ 230

Query: 229 KAKARHGKILSEDSAVKSQMMKSETSSVNL 318
           K   RH ++  +    K++ M+ +   VNL
Sbjct: 231 KKSERHAELKKKHEQHKAERMQ-KYQGVNL 259


>AL032631-3|CAE54916.1|  583|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2b protein.
          Length = 583

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/51 (45%), Positives = 29/51 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+V  L     D  L+  F +YG I S  V TD N GRS+GF F+ F+ PE
Sbjct: 256 LYVKNLDETVDDDGLKKQFESYGNITSAKVMTDEN-GRSKGFGFVCFEKPE 305



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 6/90 (6%)
 Frame = +1

Query: 67  FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVD-----PK 228
           F  +G I S  V T    G+S+GF F+ F  PE  +  V A  + TI    +       +
Sbjct: 170 FAKFGNITSCEVMTVE--GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQ 227

Query: 229 KAKARHGKILSEDSAVKSQMMKSETSSVNL 318
           K   RH ++  +    K++ M+ +   VNL
Sbjct: 228 KKSERHAELKKKHEQHKAERMQ-KYQGVNL 256


>AL032631-2|CAA21572.1|  646|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2a protein.
          Length = 646

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/51 (45%), Positives = 29/51 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L+V  L     D  L+  F +YG I S  V TD N GRS+GF F+ F+ PE
Sbjct: 319 LYVKNLDETVDDDGLKKQFESYGNITSAKVMTDEN-GRSKGFGFVCFEKPE 368



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VG L  +  +  L + F A G + SI V  D  T  S G+A++ F+ P   ++ M
Sbjct: 34  LYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAM 90



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 6/90 (6%)
 Frame = +1

Query: 67  FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVD-----PK 228
           F  +G I S  V T    G+S+GF F+ F  PE  +  V A  + TI    +       +
Sbjct: 233 FAKFGNITSCEVMTVE--GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQ 290

Query: 229 KAKARHGKILSEDSAVKSQMMKSETSSVNL 318
           K   RH ++  +    K++ M+ +   VNL
Sbjct: 291 KKSERHAELKKKHEQHKAERMQ-KYQGVNL 319


>Z81108-4|CAB03237.1|   85|Caenorhabditis elegans Hypothetical
           protein R09B3.3 protein.
          Length = 85

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 17/47 (36%), Positives = 30/47 (63%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           ++VG   ++TT+ +L ++F   G + ++ +  D  TGR RGFAF+ F
Sbjct: 6   VYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEF 52



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           +VG    + ++D++ N+FS+ G +  V +  D+   + +GF F+ F  E
Sbjct: 7   YVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEE 55


>U21320-5|AAA62536.2|  332|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 7 protein.
          Length = 332

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 20/50 (40%), Positives = 34/50 (68%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           +  LFVG +++ET++ +LR  F AYG+I+ + +  D   G+ RG+AFI +
Sbjct: 103 YRTLFVGRINYETSESKLRREFEAYGKIKKLTMVHD-EAGKPRGYAFIEY 151


>Z50874-2|CAA90772.1|  357|Caenorhabditis elegans Hypothetical
           protein R10E4.2a protein.
          Length = 357

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 26/83 (31%), Positives = 39/83 (46%)
 Frame = +3

Query: 156 GPRVNRQGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEV 335
           GP  N  G+G +      Q+       S+T   ++ GL    +DD +R   S++G I   
Sbjct: 52  GPFGNSNGYGRYTAPRGDQQHHDSTPLSST-NLYIRGLMPNTNDDLLREMCSKYGNIAST 110

Query: 336 EMPFDKTKNQRKGFCFITFESEQ 404
           +   DK  N  KG+ F+ FES Q
Sbjct: 111 KAIMDKATNNCKGYGFVDFESPQ 133


>U39997-3|AAK68389.1|  498|Caenorhabditis elegans Human daz (deleted
           in azoospermia)homolog protein 1 protein.
          Length = 498

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           FVGG  +  ++ E+R  F +F  + +V+M       Q KG+ FITFE+E    ++ K TP
Sbjct: 69  FVGGFPTSTTETELREHFEKFFAVKDVKM-VKSLDGQSKGYGFITFETEDQAEEIRKLTP 127

Query: 432 KR 437
           K+
Sbjct: 128 KQ 129



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/57 (29%), Positives = 35/57 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           ++FVGG    TT+ ELR+HF  +  ++ + +    + G+S+G+ FI F+  +  +++
Sbjct: 67  RIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLD-GQSKGYGFITFETEDQAEEI 122


>AB025253-1|BAA88577.1|  499|Caenorhabditis elegans DAZ-1 protein.
          Length = 499

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           FVGG  +  ++ E+R  F +F  + +V+M       Q KG+ FITFE+E    ++ K TP
Sbjct: 70  FVGGFPTSTTETELREHFEKFFAVKDVKM-VKSLDGQSKGYGFITFETEDQAEEIRKLTP 128

Query: 432 KR 437
           K+
Sbjct: 129 KQ 130



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/57 (29%), Positives = 35/57 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           ++FVGG    TT+ ELR+HF  +  ++ + +    + G+S+G+ FI F+  +  +++
Sbjct: 68  RIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLD-GQSKGYGFITFETEDQAEEI 123


>Z50044-2|CAA90354.1|  256|Caenorhabditis elegans Hypothetical
           protein F22B5.2 protein.
          Length = 256

 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           V  L  E+++DE+R+ F + G ++ + +  DK     KGF F+TFES
Sbjct: 180 VTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFES 226



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           V  L  E  + ELRD FG  G +  I +  D  TG  +GFAF+ F++ +   + +A
Sbjct: 180 VTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIA 235


>Z46676-8|CAB60993.2|  388|Caenorhabditis elegans Hypothetical
           protein C08B11.5 protein.
          Length = 388

 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESI-NVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +FVG L  E  +K L D F A+G I  +  +  D ++G S+GFAFI F + E+ D  + A
Sbjct: 102 IFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFASFEASDTALEA 161



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +     + G ++ V MP D+     +GF F+ F  E+  +  +K   
Sbjct: 16  YVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYAIKILN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKLYGKPIKVNKAS 90



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           FVG L  E+ +  + + FS FG IL+V ++  D      KGF FI F S +  +  L+
Sbjct: 103 FVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFASFEASDTALE 160



 Score = 33.9 bits (74), Expect = 0.098
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           ++VGGL  + ++  L +     G + S+N+  D  T   +GF F+ F   E  D
Sbjct: 15  IYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDAD 68


>U24189-3|AAC47514.1|  398|Caenorhabditis elegans RRM-type RNA
           binding protein protein.
          Length = 398

 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESI-NVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +FVG L  E  +K L D F A+G I  +  +  D ++G S+GFAFI F + E+ D  + A
Sbjct: 112 IFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFASFEASDTALEA 171



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  +     + G ++ V MP D+     +GF F+ F  E+  +  +K   
Sbjct: 26  YVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYAIKILN 85

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 86  MIKLYGKPIKVNKAS 100



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           FVG L  E+ +  + + FS FG IL+V ++  D      KGF FI F S +  +  L+
Sbjct: 113 FVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFASFEASDTALE 170



 Score = 33.9 bits (74), Expect = 0.098
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           ++VGGL  + ++  L +     G + S+N+  D  T   +GF F+ F   E  D
Sbjct: 25  IYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDAD 78


>AL117204-22|CAB55151.1|  331|Caenorhabditis elegans Hypothetical
           protein Y116A8C.34 protein.
          Length = 331

 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   L+VGG + + T+K L   F  +G++ +I++  D  +G+ RGF F+ F   E  D  
Sbjct: 9   RKRTLYVGGFTEDVTEKVLMAAFIPFGDVVAISIPMDYESGKHRGFGFVEFDMAE--DAA 66

Query: 181 MA 186
           MA
Sbjct: 67  MA 68



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGG + ++++  +   F  FG ++ + +P D    + +GF F+ F+ +E     +    
Sbjct: 14  YVGGFTEDVTEKVLMAAFIPFGDVVAISIPMDYESGKHRGFGFVEFDMAEDAAMAIDNMN 73

Query: 432 KRTIGGKEVDVKRATP 479
           +  + GK + V  A P
Sbjct: 74  ESELFGKTIRVNFARP 89


>AJ297847-1|CAC16732.1|  619|Caenorhabditis elegans FOG-1 protein
           protein.
          Length = 619

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           F+GGL   ++ +EI   FSEFG +L V +  D+     KG   +TFE +   N  L+
Sbjct: 322 FLGGLPRIVTAEEIAQMFSEFGVVLLVTIDIDQDYGYPKGAARVTFERDSAFNRALE 378



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNT-GR-----SRGFAFIVFKAPES 168
           K+FVGG+S     K +   FG +G +     VK  PN+ G+     S  + F+V+   +S
Sbjct: 206 KVFVGGISHMMNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYSYLFLVYSDEQS 265

Query: 169 IDKVMAAGEHTINN 210
           + K+M+A      N
Sbjct: 266 VIKLMSACHRNSQN 279



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 8/69 (11%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQR--------KGFCFITFESEQVV 410
           FVGG+S  ++   I  FF +FGT+  V+ P  +  N R          + F+ +  EQ V
Sbjct: 208 FVGGISHMMNRKIINKFFGQFGTVF-VDWPVKQKPNSRGKSIAIGSYSYLFLVYSDEQSV 266

Query: 411 NDLLKTPKR 437
             L+    R
Sbjct: 267 IKLMSACHR 275


>AJ297846-1|CAC16731.1|  619|Caenorhabditis elegans FOG-1 protein
           protein.
          Length = 619

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           F+GGL   ++ +EI   FSEFG +L V +  D+     KG   +TFE +   N  L+
Sbjct: 322 FLGGLPRIVTAEEIAQMFSEFGVVLLVTIDIDQDYGYPKGAARVTFERDSAFNRALE 378



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNT-GR-----SRGFAFIVFKAPES 168
           K+FVGG+S     K +   FG +G +     VK  PN+ G+     S  + F+V+   +S
Sbjct: 206 KVFVGGISHMMNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYSYLFLVYSDEQS 265

Query: 169 IDKVMAAGEHTINN 210
           + K+M+A      N
Sbjct: 266 VIKLMSACHRNSQN 279



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 8/69 (11%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQR--------KGFCFITFESEQVV 410
           FVGG+S  ++   I  FF +FGT+  V+ P  +  N R          + F+ +  EQ V
Sbjct: 208 FVGGISHMMNRKIINKFFGQFGTVF-VDWPVKQKPNSRGKSIAIGSYSYLFLVYSDEQSV 266

Query: 411 NDLLKTPKR 437
             L+    R
Sbjct: 267 IKLMSACHR 275


>AC024810-13|AAK68518.1|  405|Caenorhabditis elegans Feminization of
           germline protein1, isoform a protein.
          Length = 405

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           F+GGL   ++ +EI   FSEFG +L V +  D+     KG   +TFE +   N  L+
Sbjct: 108 FLGGLPRIVTAEEIAQMFSEFGVVLLVTIDIDQDYGYPKGAARVTFERDSAFNRALE 164


>AC024810-12|AAK68519.1|  619|Caenorhabditis elegans Feminization of
           germline protein1, isoform b protein.
          Length = 619

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           F+GGL   ++ +EI   FSEFG +L V +  D+     KG   +TFE +   N  L+
Sbjct: 322 FLGGLPRIVTAEEIAQMFSEFGVVLLVTIDIDQDYGYPKGAARVTFERDSAFNRALE 378



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNT-GR-----SRGFAFIVFKAPES 168
           K+FVGG+S     K +   FG +G +     VK  PN+ G+     S  + F+V+   +S
Sbjct: 206 KVFVGGISHMMNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYSYLFLVYSDEQS 265

Query: 169 IDKVMAAGEHTINN 210
           + K+M+A      N
Sbjct: 266 VIKLMSACHRNSQN 279



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 8/69 (11%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQR--------KGFCFITFESEQVV 410
           FVGG+S  ++   I  FF +FGT+  V+ P  +  N R          + F+ +  EQ V
Sbjct: 208 FVGGISHMMNRKIINKFFGQFGTVF-VDWPVKQKPNSRGKSIAIGSYSYLFLVYSDEQSV 266

Query: 411 NDLLKTPKR 437
             L+    R
Sbjct: 267 IKLMSACHR 275


>Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical
           protein T23F6.4 protein.
          Length = 872

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +LF+  L + T + +L+  F  YGE+  + V  D  TG  +GFA + F  PE+
Sbjct: 280 RLFLRNLPYATKEDDLQFLFKKYGEVSEVQVVIDKKTGACKGFAIVEFVFPEA 332



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 23/69 (33%), Positives = 33/69 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L V  L    T+++LR  F  YG+I   ++K     G+ RGFAF+ F    S    +A 
Sbjct: 4   RLIVKNLPSTCTEQQLRKFFEKYGQISDASLKYTKE-GKFRGFAFVGFLDEGSASNALAK 62

Query: 190 GEHTINNKK 216
              T  N K
Sbjct: 63  SNQTFFNSK 71


>Z32683-11|CAA83626.1|  142|Caenorhabditis elegans Hypothetical
           protein R07E5.14 protein.
          Length = 142

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           W  FV  +  E ++D++ + FSE+G I  + +  D+     KG+  + +E+++  N+ + 
Sbjct: 55  WIVFVTNIHEEATEDDVHDKFSEYGKIKNIHLNLDRRTGFLKGYALVEYETQKEANEAID 114

Query: 426 TPKRT-IGGKEVDV 464
               T + G+ V V
Sbjct: 115 QSNDTDLLGQNVKV 128



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FV  +  E T+ ++ D F  YG+I++I++  D  TG  +G+A + ++  +  ++ +   
Sbjct: 57  VFVTNIHEEATEDDVHDKFSEYGKIKNIHLNLDRRTGFLKGYALVEYETQKEANEAIDQS 116

Query: 193 EHTI---NNKKVD 222
             T     N KVD
Sbjct: 117 NDTDLLGQNVKVD 129


>Z78536-3|CAB01717.2|  360|Caenorhabditis elegans Hypothetical
           protein C07A4.1 protein.
          Length = 360

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 18/62 (29%), Positives = 35/62 (56%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +H  +FVG LS + +++ L+  F  +GE+    V  D  T +S+G+ F+ F   ++ +  
Sbjct: 133 KHFHVFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSFPNKQNAENA 192

Query: 181 MA 186
           +A
Sbjct: 193 IA 194



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 16/50 (32%), Positives = 34/50 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FVG LS ++S++ +++ F++FG + E ++  D    + KG+ F++F ++Q
Sbjct: 138 FVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSFPNKQ 187



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 17/57 (29%), Positives = 33/57 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++VG +S +TTD +LRD F  YG+I  + +       +++ +AF+ ++  E   K +
Sbjct: 239 VYVGNISQQTTDADLRDLFSTYGDIAEVRI------FKTQRYAFVRYEKKECATKAI 289


>AF003141-14|AAM48549.1|  362|Caenorhabditis elegans Hypothetical
           protein W02D3.11b protein.
          Length = 362

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 22/66 (33%), Positives = 35/66 (53%)
 Frame = +1

Query: 25  GLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 204
           GL WE T++ELRD FG  G IES+ +      GR+ G A +VF   E  +  +      +
Sbjct: 11  GLPWEATEQELRDFFGNNG-IESLEIPR--RNGRTSGDAKVVFTNEEDYNNALKKDREHL 67

Query: 205 NNKKVD 222
            ++ ++
Sbjct: 68  GSRYIE 73



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 25/87 (28%), Positives = 43/87 (49%)
 Frame = +3

Query: 237 STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND 416
           ST +E    GL  E ++ E+R+FF   G I  +E+P  +   +  G   + F +E+  N+
Sbjct: 2   STAYEVQCRGLPWEATEQELRDFFGNNG-IESLEIP--RRNGRTSGDAKVVFTNEEDYNN 58

Query: 417 LLKTPKRTIGGKEVDVKRATPKPDGPG 497
            LK  +  +G + ++V  A   P   G
Sbjct: 59  ALKKDREHLGSRYIEVFPAGGAPTRRG 85


>AF003141-13|AAK21490.1|  549|Caenorhabditis elegans Hypothetical
           protein W02D3.11a protein.
          Length = 549

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 22/66 (33%), Positives = 35/66 (53%)
 Frame = +1

Query: 25  GLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 204
           GL WE T++ELRD FG  G IES+ +      GR+ G A +VF   E  +  +      +
Sbjct: 11  GLPWEATEQELRDFFGNNG-IESLEIPR--RNGRTSGDAKVVFTNEEDYNNALKKDREHL 67

Query: 205 NNKKVD 222
            ++ ++
Sbjct: 68  GSRYIE 73



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 25/87 (28%), Positives = 43/87 (49%)
 Frame = +3

Query: 237 STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND 416
           ST +E    GL  E ++ E+R+FF   G I  +E+P  +   +  G   + F +E+  N+
Sbjct: 2   STAYEVQCRGLPWEATEQELRDFFGNNG-IESLEIP--RRNGRTSGDAKVVFTNEEDYNN 58

Query: 417 LLKTPKRTIGGKEVDVKRATPKPDGPG 497
            LK  +  +G + ++V  A   P   G
Sbjct: 59  ALKKDREHLGSRYIEVFPAGGAPTRRG 85


>Z50874-3|CAA90773.1|  409|Caenorhabditis elegans Hypothetical
           protein R10E4.2b protein.
          Length = 409

 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           ++ GL    +DD +R   S++G I   +   DK  N  KG+ F+ FES Q
Sbjct: 110 YIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQ 159


>Z49910-5|CAA90120.1|  411|Caenorhabditis elegans Hypothetical
           protein F44G4.4a protein.
          Length = 411

 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 22/77 (28%), Positives = 40/77 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V G+ ++TTD+  + +F   G +    +K   + G S+GF F+   +    +KV+A  
Sbjct: 175 LIVLGVDFKTTDECFQKYFEDIGTVVFCEIKRKSD-GNSKGFGFVRMSSVGEQNKVLAIP 233

Query: 193 EHTINNKKVDPKKAKAR 243
           +H I+ ++ D K    R
Sbjct: 234 QHMIDGRRCDVKVPDGR 250



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/68 (29%), Positives = 35/68 (51%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           G+  + +D+  + +F + GT++  E+   K+    KGF F+   S    N +L  P+  I
Sbjct: 179 GVDFKTTDECFQKYFEDIGTVVFCEIK-RKSDGNSKGFGFVRMSSVGEQNKVLAIPQHMI 237

Query: 444 GGKEVDVK 467
            G+  DVK
Sbjct: 238 DGRRCDVK 245



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 3/81 (3%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFG--AYGEIESINVKTDPNTGRS-RGFAFIVFKAPESIDKV 180
           ++FVG L+ +  + +LR  FG  A   IE+  V TD    +  RGFAF+   + E+ +++
Sbjct: 260 RIFVGRLTDKVDEHQLRKVFGDEAKSYIETA-VVTDVFIPKPFRGFAFVTLSSAEAAERI 318

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
           ++ G  T+N   V    A+ R
Sbjct: 319 VSKGSLTVNGLSVGLSIAQPR 339



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
 Frame = +3

Query: 213 ESRPKEG*STTWEDFVGGLSSEISDDEIRNFFS-EFGTILEVEMPFDK-TKNQRKGFCFI 386
           + R K+G  +    FVG L+ ++ + ++R  F  E  + +E  +  D       +GF F+
Sbjct: 248 DGRDKQGRPSISRIFVGRLTDKVDEHQLRKVFGDEAKSYIETAVVTDVFIPKPFRGFAFV 307

Query: 387 TFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           T  S +    ++     T+ G  V +  A P+ +
Sbjct: 308 TLSSAEAAERIVSKGSLTVNGLSVGLSIAQPREE 341


>Z36752-6|CAA85327.1|  456|Caenorhabditis elegans Hypothetical
           protein F35H8.5 protein.
          Length = 456

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 3/78 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           FV  LSS+  D  +   FS+FG I+ V++  D T+ Q KG+ F++  +  +  N +L   
Sbjct: 377 FVYNLSSDTDDTLLWQLFSQFGAIVNVKILRDLTQ-QCKGYAFVSMSNYTEAYNAMLSLN 435

Query: 432 KRTIGGKEVDV--KRATP 479
              + GK + V  K +TP
Sbjct: 436 GTNLAGKTLQVVFKSSTP 453



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 4/104 (3%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAA 189
           L +  L    T +E+R  F + GEIES  +  D  TG+S G+ F+ + +  +++  V + 
Sbjct: 44  LIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVREEDALRAVSSF 103

Query: 190 GEHTINNKKVDPKKAKARHGKILSED---SAVKSQMMKSETSSV 312
               + NK +    A+  + +I   +   S +   M   E  S+
Sbjct: 104 NGLRLQNKTIKVSYARPSNDQIKGSNLYVSGIPKSMTLHELESI 147



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           L+V G+    T  EL   F  +G+I +  + +D  TG S+G  F+ F   +  D
Sbjct: 130 LYVSGIPKSMTLHELESIFRPFGQIITSRILSDNVTGLSKGVGFVRFDKKDEAD 183


>U23484-11|AAC46764.2|  191|Caenorhabditis elegans Hypothetical
           protein EEED8.4 protein.
          Length = 191

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/59 (27%), Positives = 32/59 (54%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + +F+G + + +T +E+ +HF   G+I    +  D  T + + FA+I F    SI+  +
Sbjct: 55  KSVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNFAYIEFDDSSSIENAL 113


>AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3c protein.
          Length = 435

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 171
           L +  ++ +T  ++L + F A G +  + + TD  TGRS+G  ++ F   ES+
Sbjct: 27  LLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWDEESV 79



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 15/60 (25%), Positives = 29/60 (48%)
 Frame = +3

Query: 291 EIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKR 470
           ++  FFS  G + +V +  D    + KG C++ F  E+ V   L    + + G  + ++R
Sbjct: 40  DLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWDEESVPLGLALNGQRLMGAPLQIQR 99


>AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3a protein.
          Length = 580

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 171
           L +  ++ +T  ++L + F A G +  + + TD  TGRS+G  ++ F   ES+
Sbjct: 172 LLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWDEESV 224



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 15/60 (25%), Positives = 29/60 (48%)
 Frame = +3

Query: 291 EIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKR 470
           ++  FFS  G + +V +  D    + KG C++ F  E+ V   L    + + G  + ++R
Sbjct: 185 DLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWDEESVPLGLALNGQRLMGAPLQIQR 244


>U23484-3|AAK68298.1|  126|Caenorhabditis elegans Sr protein
           (splicing factor) protein4, isoform b protein.
          Length = 126

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           L +  LS++TT  +LR  F  YG+I  +++  D  + +S+GF F+ F
Sbjct: 21  LKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRF 67


>U23484-2|AAC46767.1|  196|Caenorhabditis elegans Sr protein
           (splicing factor) protein4, isoform a protein.
          Length = 196

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           L +  LS++TT  +LR  F  YG+I  +++  D  + +S+GF F+ F
Sbjct: 21  LKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRF 67


>AL132904-14|CAC35847.2|  258|Caenorhabditis elegans Hypothetical
           protein Y111B2A.18 protein.
          Length = 258

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 21/72 (29%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVM 183
           +K++VG L  +  +KE+ D F  YG I+ +++K    +GR   FAF+ F+   ++ D V 
Sbjct: 9   QKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIK----SGRGPAFAFVEFEDHRDAEDAVR 64

Query: 184 AAGEHTINNKKV 219
           A   +  + +++
Sbjct: 65  ARDGYEFDGRRI 76


>AF242767-1|AAG36874.1|  258|Caenorhabditis elegans SF2 protein.
          Length = 258

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 21/72 (29%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVM 183
           +K++VG L  +  +KE+ D F  YG I+ +++K    +GR   FAF+ F+   ++ D V 
Sbjct: 9   QKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIK----SGRGPAFAFVEFEDHRDAEDAVR 64

Query: 184 AAGEHTINNKKV 219
           A   +  + +++
Sbjct: 65  ARDGYEFDGRRI 76


>U55363-5|AAA97963.1|  351|Caenorhabditis elegans Spindle
           orientation defective protein4 protein.
          Length = 351

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +++V  + +   +++L   F AYG + S+ + T  N   S+GF F+   + ES +K  AA
Sbjct: 52  RIYVSNIPFSFREQDLAAMFFAYGRVLSVEIVT--NDRGSKGFGFVTLDSIESCEKARAA 109

Query: 190 -GEHTINNKKVDPKKAKARHGKILS 261
             E  +  + ++ ++A     K+++
Sbjct: 110 LHESHVQGRIIEVRRATPTRRKLIN 134


>AF067616-7|AAM98029.1|  423|Caenorhabditis elegans Hypothetical
           protein F29C4.7b protein.
          Length = 423

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/80 (26%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFVG +  +  ++E+R  F  +G++E +++KT  NT     +AF++F+  +    + A  
Sbjct: 171 LFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINT--DAAYAFVMFQTVD--QAIQAKA 226

Query: 193 EHTINNKKVDPKKAKARHGK 252
           E      +    + K  +GK
Sbjct: 227 EEQDRPIRAGGSRMKIGYGK 246



 Score = 33.9 bits (74), Expect = 0.098
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 4/74 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK-NQRKGFCFITFES-EQVVNDLLKT 428
           FVG + S++ + EIR+ F E G + EV++   KT  N    + F+ F++ +Q +    + 
Sbjct: 172 FVGNMPSDVKEREIRHVFEEHGKVEEVDI---KTPINTDAAYAFVMFQTVDQAIQAKAEE 228

Query: 429 PKRTI--GGKEVDV 464
             R I  GG  + +
Sbjct: 229 QDRPIRAGGSRMKI 242



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 2/32 (6%)
 Frame = +1

Query: 10  KLFVGGL-SWETTDKE-LRDHFGAYGEIESIN 99
           +LFVGGL SW   DKE L+  FG +G +E+I+
Sbjct: 252 RLFVGGLGSW--CDKEILQKAFGEFGFVENID 281


>AF067616-6|AAC19192.1|  520|Caenorhabditis elegans Hypothetical
           protein F29C4.7a protein.
          Length = 520

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/80 (26%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFVG +  +  ++E+R  F  +G++E +++KT  NT     +AF++F+  +    + A  
Sbjct: 171 LFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINT--DAAYAFVMFQTVD--QAIQAKA 226

Query: 193 EHTINNKKVDPKKAKARHGK 252
           E      +    + K  +GK
Sbjct: 227 EEQDRPIRAGGSRMKIGYGK 246



 Score = 33.9 bits (74), Expect = 0.098
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 4/74 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK-NQRKGFCFITFES-EQVVNDLLKT 428
           FVG + S++ + EIR+ F E G + EV++   KT  N    + F+ F++ +Q +    + 
Sbjct: 172 FVGNMPSDVKEREIRHVFEEHGKVEEVDI---KTPINTDAAYAFVMFQTVDQAIQAKAEE 228

Query: 429 PKRTI--GGKEVDV 464
             R I  GG  + +
Sbjct: 229 QDRPIRAGGSRMKI 242



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 2/32 (6%)
 Frame = +1

Query: 10  KLFVGGL-SWETTDKE-LRDHFGAYGEIESIN 99
           +LFVGGL SW   DKE L+  FG +G +E+I+
Sbjct: 252 RLFVGGLGSW--CDKEILQKAFGEFGFVENID 281


>AF067616-5|AAU05574.1|  497|Caenorhabditis elegans Hypothetical
           protein F29C4.7c protein.
          Length = 497

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/80 (26%), Positives = 41/80 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFVG +  +  ++E+R  F  +G++E +++KT  NT     +AF++F+  +    + A  
Sbjct: 148 LFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINT--DAAYAFVMFQTVD--QAIQAKA 203

Query: 193 EHTINNKKVDPKKAKARHGK 252
           E      +    + K  +GK
Sbjct: 204 EEQDRPIRAGGSRMKIGYGK 223



 Score = 33.9 bits (74), Expect = 0.098
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 4/74 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK-NQRKGFCFITFES-EQVVNDLLKT 428
           FVG + S++ + EIR+ F E G + EV++   KT  N    + F+ F++ +Q +    + 
Sbjct: 149 FVGNMPSDVKEREIRHVFEEHGKVEEVDI---KTPINTDAAYAFVMFQTVDQAIQAKAEE 205

Query: 429 PKRTI--GGKEVDV 464
             R I  GG  + +
Sbjct: 206 QDRPIRAGGSRMKI 219



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 2/32 (6%)
 Frame = +1

Query: 10  KLFVGGL-SWETTDKE-LRDHFGAYGEIESIN 99
           +LFVGGL SW   DKE L+  FG +G +E+I+
Sbjct: 229 RLFVGGLGSW--CDKEILQKAFGEFGFVENID 258


>AB052819-1|BAC65239.1|  351|Caenorhabditis elegans PIP-1 protein.
          Length = 351

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +++V  + +   +++L   F AYG + S+ + T  N   S+GF F+   + ES +K  AA
Sbjct: 52  RIYVSNIPFSFREQDLAAMFFAYGRVLSVEIVT--NDRGSKGFGFVTLDSIESCEKARAA 109

Query: 190 -GEHTINNKKVDPKKAKARHGKILS 261
             E  +  + ++ ++A     K+++
Sbjct: 110 LHESHVQGRIIEVRRATPTRRKLIN 134


>Z81473-3|CAB03896.4|  514|Caenorhabditis elegans Hypothetical
           protein C17D12.2 protein.
          Length = 514

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 18/50 (36%), Positives = 32/50 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           +KLF+G LS + ++ E+R  F  +GE++ + V    + G S+G AF+ +K
Sbjct: 124 KKLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGAD-GASKGCAFVKYK 172



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG +   + + ++R+ F +FG I E  +  DK     KG  F+T+
Sbjct: 32  FVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTY 77



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           F+G LS + S+DE+R  F+ FG + EV +         KG  F+ ++
Sbjct: 127 FIGMLSKQQSEDEVRALFATFGELDEVTV-LRGADGASKGCAFVKYK 172


>U23484-10|AAC46772.1|  197|Caenorhabditis elegans Hypothetical
           protein EEED8.12 protein.
          Length = 197

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 16/59 (27%), Positives = 31/59 (52%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + +F+G + + +T +E+ +HF   G I    +  D  T + + FA+I F    SI+  +
Sbjct: 61  KSVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEFDDSSSIENAL 119


>AY342388-1|AAQ19851.1|  514|Caenorhabditis elegans putative
           RNA-binding protein protein.
          Length = 514

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 18/50 (36%), Positives = 32/50 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           +KLF+G LS + ++ E+R  F  +GE++ + V    + G S+G AF+ +K
Sbjct: 124 KKLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGAD-GASKGCAFVKYK 172



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG +   + + ++R+ F +FG I E  +  DK     KG  F+T+
Sbjct: 32  FVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTY 77



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           F+G LS + S+DE+R  F+ FG + EV +         KG  F+ ++
Sbjct: 127 FIGMLSKQQSEDEVRALFATFGELDEVTV-LRGADGASKGCAFVKYK 172


>AC024818-2|AAF60781.1|  302|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 262 protein.
          Length = 302

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/77 (22%), Positives = 43/77 (55%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           F G L +E+SD+ +   F ++ +  + ++  +   N+ KG+ F++F +SE  V  + +  
Sbjct: 206 FCGDLGNEVSDELLAKAFRKYPSFQKAKVVRESRTNKSKGYGFVSFRDSEDYVRAMREMD 265

Query: 432 KRTIGGKEVDVKRATPK 482
            + +G + + ++++  K
Sbjct: 266 GKYVGNRPIKLRKSAWK 282


>Z73102-13|CAA97405.1|  836|Caenorhabditis elegans Hypothetical
           protein B0035.12 protein.
          Length = 836

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 4/85 (4%)
 Frame = +3

Query: 237 STTWED---FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           STT E    FV  +  + +DDE++  FS+FGT+  V     K   + KG  F+ F++E  
Sbjct: 677 STTLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHK-DGKPKGIAFVDFDTEAS 735

Query: 408 VNDLLKT-PKRTIGGKEVDVKRATP 479
               + +  K  +  +E++V  + P
Sbjct: 736 AQKCVASGDKLMLRERELEVALSNP 760


>U80455-1|AAB37881.1|  584|Caenorhabditis elegans Elav-type rna
           binding protein familyprotein 1, isoform a protein.
          Length = 584

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           P E  +   + FVG +  + ++ + R  F ++G++    +  DK+    KG CF+TF
Sbjct: 47  PSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +  +  + + R  F  YG + S N+  D +T  S+G  F+ F
Sbjct: 56  KMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 31.5 bits (68), Expect = 0.52
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+G LS + +++ +R  F++FG I +  +  D+    R G  F+TF
Sbjct: 145 FIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSR-GCAFVTF 189


>U79157-1|AAC26982.1|  496|Caenorhabditis elegans splicing factor
           U2AF65 protein.
          Length = 496

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/59 (27%), Positives = 36/59 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+F+GGL    T+ ++++   ++G +++ ++  D + G S+G+AF  +  P   D+ +A
Sbjct: 292 KIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIA 349



 Score = 31.1 bits (67), Expect = 0.69
 Identities = 12/46 (26%), Positives = 24/46 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+GGL + +++D+++     FG +    +  D   N  KG+ F  +
Sbjct: 294 FIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDSQGNS-KGYAFAEY 338


>U53931-1|AAA98566.1|  584|Caenorhabditis elegans elav-type
           ribonucleoprotein protein.
          Length = 584

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           P E  +   + FVG +  + ++ + R  F ++G++    +  DK+    KG CF+TF
Sbjct: 47  PSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +  +  + + R  F  YG + S N+  D +T  S+G  F+ F
Sbjct: 56  KMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 31.5 bits (68), Expect = 0.52
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+G LS + +++ +R  F++FG I +  +  D+    R G  F+TF
Sbjct: 145 FIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSR-GCAFVTF 189


>EF523770-1|ABS18836.1|  513|Caenorhabditis elegans ELAV-type RNA
           binding protein variantE protein.
          Length = 513

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           P E  +   + FVG +  + ++ + R  F ++G++    +  DK+    KG CF+TF
Sbjct: 47  PSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +  +  + + R  F  YG + S N+  D +T  S+G  F+ F
Sbjct: 56  KMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 31.5 bits (68), Expect = 0.52
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+G LS + +++ +R  F++FG I +  +  D+    R G  F+TF
Sbjct: 145 FIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSR-GCAFVTF 189


>EF523769-1|ABS18835.1|  327|Caenorhabditis elegans ELAV-type RNA
           binding protein variantD protein.
          Length = 327

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           P E  +   + FVG +  + ++ + R  F ++G++    +  DK+    KG CF+TF
Sbjct: 47  PSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +  +  + + R  F  YG + S N+  D +T  S+G  F+ F
Sbjct: 56  KMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 31.5 bits (68), Expect = 0.52
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+G LS + +++ +R  F++FG I +  +  D+    R G  F+TF
Sbjct: 145 FIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSR-GCAFVTF 189


>EF523768-1|ABS18834.1|  378|Caenorhabditis elegans ELAV-type RNA
           binding protein variantC protein.
          Length = 378

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           P E  +   + FVG +  + ++ + R  F ++G++    +  DK+    KG CF+TF
Sbjct: 47  PSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +  +  + + R  F  YG + S N+  D +T  S+G  F+ F
Sbjct: 56  KMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 31.5 bits (68), Expect = 0.52
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+G LS + +++ +R  F++FG I +  +  D+    R G  F+TF
Sbjct: 145 FIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSR-GCAFVTF 189


>EF523767-1|ABS18833.1|  193|Caenorhabditis elegans ELAV-type RNA
           binding protein variantB protein.
          Length = 193

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           P E  +   + FVG +  + ++ + R  F ++G++    +  DK+    KG CF+TF
Sbjct: 47  PSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +  +  + + R  F  YG + S N+  D +T  S+G  F+ F
Sbjct: 56  KMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103


>EF523766-1|ABS18832.1|  584|Caenorhabditis elegans ELAV-type RNA
           binding protein variantA protein.
          Length = 584

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           P E  +   + FVG +  + ++ + R  F ++G++    +  DK+    KG CF+TF
Sbjct: 47  PSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+FVG +  +  + + R  F  YG + S N+  D +T  S+G  F+ F
Sbjct: 56  KMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTF 103



 Score = 31.5 bits (68), Expect = 0.52
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+G LS + +++ +R  F++FG I +  +  D+    R G  F+TF
Sbjct: 145 FIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSR-GCAFVTF 189


>AC024875-3|AAK29989.1|  496|Caenorhabditis elegans U2af splicing
           factor protein 1,isoform a protein.
          Length = 496

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/59 (27%), Positives = 36/59 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+F+GGL    T+ ++++   ++G +++ ++  D + G S+G+AF  +  P   D+ +A
Sbjct: 292 KIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIA 349



 Score = 31.1 bits (67), Expect = 0.69
 Identities = 12/46 (26%), Positives = 24/46 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+GGL + +++D+++     FG +    +  D   N  KG+ F  +
Sbjct: 294 FIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDSQGNS-KGYAFAEY 338


>AC024875-2|AAM44400.1|  471|Caenorhabditis elegans U2af splicing
           factor protein 1,isoform d protein.
          Length = 471

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/59 (27%), Positives = 36/59 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+F+GGL    T+ ++++   ++G +++ ++  D + G S+G+AF  +  P   D+ +A
Sbjct: 267 KIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIA 324



 Score = 31.1 bits (67), Expect = 0.69
 Identities = 12/46 (26%), Positives = 24/46 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+GGL + +++D+++     FG +    +  D   N  KG+ F  +
Sbjct: 269 FIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDSQGNS-KGYAFAEY 313


>AC024875-1|AAL00879.1|  474|Caenorhabditis elegans U2af splicing
           factor protein 1,isoform c protein.
          Length = 474

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/59 (27%), Positives = 36/59 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+F+GGL    T+ ++++   ++G +++ ++  D + G S+G+AF  +  P   D+ +A
Sbjct: 270 KIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIA 327



 Score = 31.1 bits (67), Expect = 0.69
 Identities = 12/46 (26%), Positives = 24/46 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+GGL + +++D+++     FG +    +  D   N  KG+ F  +
Sbjct: 272 FIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDSQGNS-KGYAFAEY 316


>Z97628-2|CAB10726.2|  427|Caenorhabditis elegans Hypothetical
           protein F39H2.2a protein.
          Length = 427

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/96 (25%), Positives = 47/96 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  L+  TTD++L   F  +G+I +  +  D  +G S  +AFI F   +S ++     
Sbjct: 243 LFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEFDNAKSCEQAF--- 299

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
              ++N  +D ++      + +S++   K +  + E
Sbjct: 300 -FKMDNVLIDDRRIHVDFSQSVSQNYKYKPKSQQQE 334


>Z81080-5|CAB03088.2|  427|Caenorhabditis elegans Hypothetical
           protein F39H2.2a protein.
          Length = 427

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/96 (25%), Positives = 47/96 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  L+  TTD++L   F  +G+I +  +  D  +G S  +AFI F   +S ++     
Sbjct: 243 LFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEFDNAKSCEQAF--- 299

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
              ++N  +D ++      + +S++   K +  + E
Sbjct: 300 -FKMDNVLIDDRRIHVDFSQSVSQNYKYKPKSQQQE 334


>Z81080-2|CAD56584.1|  358|Caenorhabditis elegans Hypothetical
           protein F39H2.2b protein.
          Length = 358

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/96 (25%), Positives = 47/96 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  L+  TTD++L   F  +G+I +  +  D  +G S  +AFI F   +S ++     
Sbjct: 174 LFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEFDNAKSCEQAF--- 230

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
              ++N  +D ++      + +S++   K +  + E
Sbjct: 231 -FKMDNVLIDDRRIHVDFSQSVSQNYKYKPKSQQQE 265


>Z78419-2|CAB01702.1|  154|Caenorhabditis elegans Hypothetical
           protein F26A3.2 protein.
          Length = 154

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           +VG LS    +D++   F   G +  V M  D+ K    GFCF+ + + +
Sbjct: 40  YVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYYTRE 89



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 18/76 (23%), Positives = 37/76 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+VG LS+ T + ++ + FG  G++  + +  D       GF F+ +   E  +  +   
Sbjct: 39  LYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYYTREDAELAL--- 95

Query: 193 EHTINNKKVDPKKAKA 240
              I+N ++D +  +A
Sbjct: 96  -QNISNTRMDDRVIRA 110


>Z69384-5|CAA93419.2|  408|Caenorhabditis elegans Hypothetical
           protein T11G6.8 protein.
          Length = 408

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 4/94 (4%)
 Frame = +1

Query: 13  LFVGGL----SWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           L++G L    + + T+K+L D F  YG+I  + V T+      +G AFI F   E+ ++ 
Sbjct: 237 LYIGNLGPSGAQQVTEKDLNDFFYQYGDIRCLRVLTE------KGCAFIEFTTREAAER- 289

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKS 282
             A E + N   +  K+   R G+  ++ +A  S
Sbjct: 290 --AAERSFNKTFIKGKRLTIRWGEPQAKRAADNS 321


>AF040642-5|AAN73870.2|  138|Caenorhabditis elegans Hypothetical
           protein C50D2.5 protein.
          Length = 138

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 21/62 (33%), Positives = 33/62 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L++  L ++ T +E+ + FG +G +  I V    NT  +RG AF+V+   E I     A 
Sbjct: 21  LYIKNLPYKITTEEMYEIFGKFGAVRQIRVG---NTAETRGTAFVVY---EDIFDAKTAC 74

Query: 193 EH 198
           EH
Sbjct: 75  EH 76


>AF003145-3|AAB57717.1|  751|Caenorhabditis elegans Cpeb polya
           binding family protein 3 protein.
          Length = 751

 Score = 35.1 bits (77), Expect = 0.042
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYG 81
           K+FVGG+ W+ T+  L+D FG +G
Sbjct: 296 KIFVGGVPWDITEAALKDSFGEFG 319


>AC006833-6|AAF60950.1|  491|Caenorhabditis elegans Hypothetical
           protein ZK616.1 protein.
          Length = 491

 Score = 35.1 bits (77), Expect = 0.042
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPF-DKTKNQRKGFCFITFESEQVVNDLL 422
           +VGG S+ +S ++IRN  ++     EV +   +    + +GF F+   S    N LL
Sbjct: 12  YVGGFSTNLSSEQIRNLITQLAAPFEVSIDIVENGSRKHRGFAFVQCRSLAEANVLL 68


>Z66521-4|CAD59160.1|  150|Caenorhabditis elegans Hypothetical
           protein W02B12.3c protein.
          Length = 150

 Score = 34.7 bits (76), Expect = 0.056
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++G L+S +S+ +I +FF  +G I +V +        + GF F+ F+ ++   D +    
Sbjct: 6   YIGRLTSRVSEKDIEHFFRGYGQIRDVLL--------KNGFGFVEFDDKRDAEDAVHDLN 57

Query: 435 -RTIGGKEVDVKRATPKPDG 491
            + +GG+ V +  + P+  G
Sbjct: 58  GKELGGERVILDYSKPRGGG 77



 Score = 27.5 bits (58), Expect = 8.5
 Identities = 16/81 (19%), Positives = 37/81 (45%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++++G L+   ++K++   F  YG+I  + +K         GF F+ F      +  +  
Sbjct: 4   RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLK--------NGFGFVEFDDKRDAEDAV-- 53

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +N K++  ++    + K
Sbjct: 54  --HDLNGKELGGERVILDYSK 72


>Z66521-3|CAD59159.1|  148|Caenorhabditis elegans Hypothetical
           protein W02B12.3b protein.
          Length = 148

 Score = 34.7 bits (76), Expect = 0.056
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++G L+S +S+ +I +FF  +G I +V +        + GF F+ F+ ++   D +    
Sbjct: 6   YIGRLTSRVSEKDIEHFFRGYGQIRDVLL--------KNGFGFVEFDDKRDAEDAVHDLN 57

Query: 435 -RTIGGKEVDVKRATPKPDG 491
            + +GG+ V +  + P+  G
Sbjct: 58  GKELGGERVILDYSKPRGGG 77



 Score = 27.5 bits (58), Expect = 8.5
 Identities = 16/81 (19%), Positives = 37/81 (45%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++++G L+   ++K++   F  YG+I  + +K         GF F+ F      +  +  
Sbjct: 4   RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLK--------NGFGFVEFDDKRDAEDAV-- 53

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +N K++  ++    + K
Sbjct: 54  --HDLNGKELGGERVILDYSK 72


>Z66521-2|CAA91395.1|  312|Caenorhabditis elegans Hypothetical
           protein W02B12.3a protein.
          Length = 312

 Score = 34.7 bits (76), Expect = 0.056
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++G L+S +S+ +I +FF  +G I +V +        + GF F+ F+ ++   D +    
Sbjct: 6   YIGRLTSRVSEKDIEHFFRGYGQIRDVLL--------KNGFGFVEFDDKRDAEDAVHDLN 57

Query: 435 -RTIGGKEVDVKRATPKPDG 491
            + +GG+ V +  + P+  G
Sbjct: 58  GKELGGERVILDYSKPRGGG 77



 Score = 27.5 bits (58), Expect = 8.5
 Identities = 16/81 (19%), Positives = 37/81 (45%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++++G L+   ++K++   F  YG+I  + +K         GF F+ F      +  +  
Sbjct: 4   RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLK--------NGFGFVEFDDKRDAEDAV-- 53

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +N K++  ++    + K
Sbjct: 54  --HDLNGKELGGERVILDYSK 72


>Z19154-9|CAA79552.2|  559|Caenorhabditis elegans Hypothetical
           protein C40H1.1 protein.
          Length = 559

 Score = 33.9 bits (74), Expect = 0.098
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)
 Frame = +1

Query: 13  LFVGGLSWETTDKEL-RDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+GG+   T  ++L R   G YG++  + +  DP     +G A + F   ++  + ++ 
Sbjct: 367 VFIGGVPRPTRAQDLARCLEGHYGKVSYVGIDIDPELKYPKGAARVTFSTSQAFVRAISG 426

Query: 190 G----EHTINNKKVDPK 228
                 H  NNK+V+ K
Sbjct: 427 RFVQVNHAENNKRVEIK 443



 Score = 27.5 bits (58), Expect = 8.5
 Identities = 9/26 (34%), Positives = 20/26 (76%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI 87
           K+F+GGL  + +++++   FGA+G++
Sbjct: 246 KVFIGGLPIDVSEEQVWATFGAFGKV 271


>Z83119-2|CAB05579.2|  608|Caenorhabditis elegans Hypothetical
           protein R05H10.2 protein.
          Length = 608

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 13/50 (26%), Positives = 30/50 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           +F+  LS++T ++ +++    +G+I+   +    ++G S+G AF+ F  P
Sbjct: 265 VFLRNLSYDTKEELIKEELSKFGKIDLAIICKYKDSGHSKGTAFVHFSTP 314


>AL137227-1|CAB70238.2|  611|Caenorhabditis elegans Hypothetical
           protein F58D5.1 protein.
          Length = 611

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 16/50 (32%), Positives = 28/50 (56%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           HE ++VG +  +  +  L   F   G+I  + +  DP +G SRG+AF+ +
Sbjct: 200 HE-IYVGHIPTDVFEDTLVPLFEKSGKIWDLRLMMDPMSGASRGYAFVTY 248


>U23450-1|AAK31467.2|  422|Caenorhabditis elegans Cpeb polya binding
           family protein 2 protein.
          Length = 422

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP 344
           FVGGL S + + +I NFFS +G  L+V+ P
Sbjct: 91  FVGGLPSCVKESDILNFFSRYGR-LQVDWP 119


>U23172-15|AAN63408.1|  374|Caenorhabditis elegans Hypothetical
           protein F25B5.7d protein.
          Length = 374

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 195 THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKG 374
           T  Q  +  PK+  +     FVG L +E+ + E++  FS  G I E  +         KG
Sbjct: 99  TESQLMDEVPKKKFTGRCRLFVGNLPNEVKETELKELFSPHGDIAECYL-------SGKG 151

Query: 375 FCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRA 473
           F F+  ++        +    R I G++V V+ A
Sbjct: 152 FAFLRLDTRAHAESAKEAIDGRIIHGRQVRVRFA 185


>U23172-12|ABH03526.1|  562|Caenorhabditis elegans Hypothetical
           protein F25B5.7a protein.
          Length = 562

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 195 THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKG 374
           T  Q  +  PK+  +     FVG L +E+ + E++  FS  G I E  +         KG
Sbjct: 99  TESQLMDEVPKKKFTGRCRLFVGNLPNEVKETELKELFSPHGDIAECYL-------SGKG 151

Query: 375 FCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRA 473
           F F+  ++        +    R I G++V V+ A
Sbjct: 152 FAFLRLDTRAHAESAKEAIDGRIIHGRQVRVRFA 185


>Z36238-3|CAA85276.1|  404|Caenorhabditis elegans Hypothetical
           protein R74.5a protein.
          Length = 404

 Score = 31.5 bits (68), Expect = 0.52
 Identities = 28/132 (21%), Positives = 57/132 (43%), Gaps = 2/132 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L V  + ++  + +L   F   G +  ++V+   N   S+GF F+  + P+  D+  A 
Sbjct: 101 RLHVSNIPFKYREPDLTAMFEKVGPV--VDVEIIFNERGSKGFGFVTMQNPDDADRARAE 158

Query: 190 -GEHTINNKKVDPKKAKAR-HGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRT 363
               TI  ++V+   A  R H K      +V    M ++ + ++ +   +    L +Q  
Sbjct: 159 FNGTTIEGRRVEVNLATQRVHNKKAKPLMSVGVDAMSAQNALISQQQQIQRAALLQQQLL 218

Query: 364 KERASVSSHLNL 399
            ++  V  H  L
Sbjct: 219 AQQFLVPRHQQL 230


>DQ485531-1|ABF22491.1|  404|Caenorhabditis elegans RNA-binding
           protein ASD-1 protein.
          Length = 404

 Score = 31.5 bits (68), Expect = 0.52
 Identities = 28/132 (21%), Positives = 57/132 (43%), Gaps = 2/132 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L V  + ++  + +L   F   G +  ++V+   N   S+GF F+  + P+  D+  A 
Sbjct: 101 RLHVSNIPFKYREPDLTAMFEKVGPV--VDVEIIFNERGSKGFGFVTMQNPDDADRARAE 158

Query: 190 -GEHTINNKKVDPKKAKAR-HGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRT 363
               TI  ++V+   A  R H K      +V    M ++ + ++ +   +    L +Q  
Sbjct: 159 FNGTTIEGRRVEVNLATQRVHNKKAKPLMSVGVDAMSAQNALISQQQQIQRAALLQQQLL 218

Query: 364 KERASVSSHLNL 399
            ++  V  H  L
Sbjct: 219 AQQFLVPRHQQL 230


>Z75552-9|CAA99945.2|  705|Caenorhabditis elegans Hypothetical
           protein W04D2.6a protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 0.69
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILE-VEMPFDKTKNQRKGFCF 383
           QQ S+ K   S     FVG +S + SD+ IR   +E G +     +     K Q  GFC 
Sbjct: 37  QQSSQQKPDSSPV---FVGNISDKCSDEFIRKILNECGNVASWKRIKGSNGKLQGFGFCH 93

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVK 467
            T + E  +  L    +  +G K++ VK
Sbjct: 94  FT-DLEGTLRALRILHEFHLGDKKLTVK 120


>Z75551-6|CAA99937.2|  705|Caenorhabditis elegans Hypothetical
           protein W04D2.6a protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 0.69
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILE-VEMPFDKTKNQRKGFCF 383
           QQ S+ K   S     FVG +S + SD+ IR   +E G +     +     K Q  GFC 
Sbjct: 37  QQSSQQKPDSSPV---FVGNISDKCSDEFIRKILNECGNVASWKRIKGSNGKLQGFGFCH 93

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVK 467
            T + E  +  L    +  +G K++ VK
Sbjct: 94  FT-DLEGTLRALRILHEFHLGDKKLTVK 120


>AF039713-10|AAB96721.1|  691|Caenorhabditis elegans Hypothetical
           protein F57B10.4 protein.
          Length = 691

 Score = 31.1 bits (67), Expect = 0.69
 Identities = 23/81 (28%), Positives = 45/81 (55%)
 Frame = +1

Query: 166 SIDKVMAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCP 345
           SID+V +A +H + N+KVD +K ++  GK++ +      ++ +    + NLE S   +  
Sbjct: 135 SIDEVSSAVQH-LENEKVDVEKRQSSTGKLIFQTEKEIMKLKEEIQVNTNLE-SNIIQLS 192

Query: 346 LTKQRTKERASVSSHLNLSKL 408
           L K  + + +S S ++  +KL
Sbjct: 193 LEKLSSVKDSSTSENVYKAKL 213


>L07144-4|AAK21440.2|  187|Caenorhabditis elegans Hypothetical
           protein R05D3.8 protein.
          Length = 187

 Score = 30.7 bits (66), Expect = 0.91
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWET-TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++LFV     +  T KEL+ +FGAYG+I  +   +D + G    F  I F    S+D ++
Sbjct: 31  KRLFVSYFPLDRLTSKELKMNFGAYGKITDVEFVSD-SEGPLH-FCIITFADSRSVDVLL 88


>Z35663-4|CAA84724.1|  307|Caenorhabditis elegans Hypothetical
           protein T04A8.6 protein.
          Length = 307

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 9/41 (21%), Positives = 24/41 (58%)
 Frame = +3

Query: 285 DDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           + E+  +F +FG +L + +  ++     KG+ ++ F+++ V
Sbjct: 45  EKELLGYFRQFGNVLRIRVARNRRTGNHKGWAYVGFDNKAV 85


>U41007-10|AAL32214.1|  118|Caenorhabditis elegans Sr protein
           (splicing factor) protein6, isoform c protein.
          Length = 118

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-P 431
           +VGGL S+ +  E+   F  FG I +V +       +  GF F+ ++  +   D ++   
Sbjct: 6   YVGGLPSDATSQELEEIFDRFGRIRKVWV-----ARRPPGFAFVEYDDVRDAEDAVRALD 60

Query: 432 KRTIGGKEVDVKRATPKPDGPG 497
              I G    V+ +T +  G G
Sbjct: 61  GSRICGVRARVELSTGQRRGGG 82


>U41007-9|AAL32213.1|  153|Caenorhabditis elegans Sr protein
           (splicing factor) protein6, isoform b protein.
          Length = 153

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-P 431
           +VGGL S+ +  E+   F  FG I +V +       +  GF F+ ++  +   D ++   
Sbjct: 6   YVGGLPSDATSQELEEIFDRFGRIRKVWV-----ARRPPGFAFVEYDDVRDAEDAVRALD 60

Query: 432 KRTIGGKEVDVKRATPKPDGPG 497
              I G    V+ +T +  G G
Sbjct: 61  GSRICGVRARVELSTGQRRGGG 82


>U41007-8|AAA82270.1|  179|Caenorhabditis elegans Sr protein
           (splicing factor) protein6, isoform a protein.
          Length = 179

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-P 431
           +VGGL S+ +  E+   F  FG I +V +       +  GF F+ ++  +   D ++   
Sbjct: 6   YVGGLPSDATSQELEEIFDRFGRIRKVWV-----ARRPPGFAFVEYDDVRDAEDAVRALD 60

Query: 432 KRTIGGKEVDVKRATPKPDGPG 497
              I G    V+ +T +  G G
Sbjct: 61  GSRICGVRARVELSTGQRRGGG 82


>Z99279-4|CAB16494.1|  121|Caenorhabditis elegans Hypothetical
           protein Y57G11A.5 protein.
          Length = 121

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 6/57 (10%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKEL-RDHFGAYGEIESI-----NVKTDPNTGRSRGFAFIVFK 156
           + +++VG + ++ T+KEL  D    Y  IE++      +K+     R  GFAF+ FK
Sbjct: 16  NRQVYVGNMPFDATEKELNNDALTIYDAIEAVFSVMGPIKSIWMAKRPPGFAFVTFK 72


>Z81120-1|CAB03342.1|  207|Caenorhabditis elegans Hypothetical
           protein T12D8.2 protein.
          Length = 207

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +3

Query: 330 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRA 473
           ++ +  D+     KGF ++TFE+EQ +N  +        G + + V RA
Sbjct: 40  DIHLVHDRDSGSFKGFAYVTFENEQQMNTAISGLNGADFGNRVLKVNRA 88


>U23172-14|AAL02495.1|  165|Caenorhabditis elegans Hypothetical
           protein F25B5.7b protein.
          Length = 165

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +3

Query: 195 THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILE 332
           T  Q  +  PK+  +     FVG L +E+ + E++  FS  G I E
Sbjct: 99  TESQLMDEVPKKKFTGRCRLFVGNLPNEVKETELKELFSPHGDIAE 144


>U14635-1|AAC46657.2|  448|Caenorhabditis elegans Hypothetical
           protein C27H5.3 protein.
          Length = 448

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 6/55 (10%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIES------INVKTDPNTGRSRGFAFIVF 153
           E +FV G+S    +  + D F   G+I        I + TD NTG  +G   I F
Sbjct: 201 ETVFVQGISTTANEAYIADVFSTCGDIAKNDRGPRIKIYTDRNTGEPKGECMITF 255


>L07144-9|AAK21441.1|  737|Caenorhabditis elegans Hypothetical
           protein R05D3.2 protein.
          Length = 737

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = -2

Query: 436 LLGVLSKSFTTCSDSNVMKQKPFLWFFVLSKGISTSKI 323
           L+G L       S+ ++    PF +FF+ S+G STSKI
Sbjct: 156 LIGALWNYVFVLSNVSLFVLLPFSYFFIESQGFSTSKI 193


>Z68160-1|CAA92294.2|  489|Caenorhabditis elegans Hypothetical
           protein D1046.1 protein.
          Length = 489

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 4/60 (6%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIES--INVKTDPN--TGRSRGFAFIVFKAPESIDKVM 183
           +VG L W TTD +L     + G   S   ++K   N   G+S+G+A +V  +  ++ + M
Sbjct: 87  YVGNLLWYTTDADLLKALQSTGLARSQFADMKFFENRTNGQSKGYALLVLNSDAAVKQTM 146


>U28944-8|AAK68193.1|  103|Caenorhabditis elegans Hypothetical
           protein C18A3.5c protein.
          Length = 103

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +VG L S +++D I   F++ G++ + ++ FD+
Sbjct: 49  YVGNLDSTVTEDFIATLFNQIGSVTKTKVIFDE 81


>Z99277-2|CAB16487.1|  557|Caenorhabditis elegans Hypothetical
           protein Y53C12A.3 protein.
          Length = 557

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESIN--VKTDPNTGRSRGFAFIVFKAPESI 171
           +G + WE   K+++D F +YG I+        DP   R+R     + + P  I
Sbjct: 69  LGKMMWEAGSKQVQDTFQSYGRIDLFRPYFDVDPAEVRTRLIRSFIPRKPSQI 121


>Z68879-10|CAA93082.2|  473|Caenorhabditis elegans Hypothetical
           protein K08F4.2 protein.
          Length = 473

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 11/71 (15%)
 Frame = +1

Query: 10  KLFVGGLSWETT-------DKELRDHFGAYGEIESI----NVKTDPNTGRSRGFAFIVFK 156
           K+++GG++ E         + E++  F  YGEIE +     V   PN      FAFI  +
Sbjct: 327 KIYLGGITREIVPSNTAQAESEIKQVFYKYGEIEEVRMPRKVLDSPNDTSKHAFAFITMR 386

Query: 157 APESIDKVMAA 189
               +  +  A
Sbjct: 387 NKAGVKAIFEA 397


>Z66521-8|CAA91394.1|  281|Caenorhabditis elegans Hypothetical
           protein W02B12.2 protein.
          Length = 281

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 17/68 (25%), Positives = 35/68 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++G L +  SD ++ +FF  +G + +V M        + GF F+ F+ ++  +D +    
Sbjct: 5   YIGRLPNRASDRDVEHFFRGYGKLSDVIM--------KNGFGFVDFQDQRDADDAV---- 52

Query: 435 RTIGGKEV 458
             + GKE+
Sbjct: 53  HDLNGKEL 60


>AC024791-14|AAF60658.1|  767|Caenorhabditis elegans P300/cbp
           associated factor homologprotein 1 protein.
          Length = 767

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +1

Query: 127 SRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKILSEDSAV 276
           SRGF  IVF A  ++++V   G H +N+ K    K K  H    +++ A+
Sbjct: 487 SRGFVEIVFCAITAMEQVKGYGTHLMNHCKDYMIKNKIYHMLTYADEFAI 536


>Z36238-4|CAD82915.1|  286|Caenorhabditis elegans Hypothetical
           protein R74.5b protein.
          Length = 286

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 2/104 (1%)
 Frame = +1

Query: 94  INVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKAR-HGKILSED 267
           ++V+   N   S+GF F+  + P+  D+  A     TI  ++V+   A  R H K     
Sbjct: 9   VDVEIIFNERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKKAKPL 68

Query: 268 SAVKSQMMKSETSSVNLELS*KWRCPLTKQRTKERASVSSHLNL 399
            +V    M ++ + ++ +   +    L +Q   ++  V  H  L
Sbjct: 69  MSVGVDAMSAQNALISQQQQIQRAALLQQQLLAQQFLVPRHQQL 112


>Z37983-4|CAA86057.1|  803|Caenorhabditis elegans Hypothetical
           protein B0393.4 protein.
          Length = 803

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 11/41 (26%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = -2

Query: 124 CLCLDLSLH*YSLFHRMLQNDHGAPYLWSP-SSAHQQKVSR 5
           C+  +++++ +SLF  +++  H     W P S +H+++ SR
Sbjct: 548 CMLAEMAMNEFSLFSGIVEKFHAIVGPWMPESESHRRRASR 588


>AF047659-10|AAC04430.1|  798|Caenorhabditis elegans Hypothetical
           protein K07H8.10 protein.
          Length = 798

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 1/83 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +LF+  L     + +L++ F +  +I+ ++    PN   S+  AFI F   E      A 
Sbjct: 639 QLFINALPGTCNNTDLKNIFRSSTDIKILHASGQPN---SKKRAFITFGTVEDAQAAFAK 695

Query: 190 GEH-TINNKKVDPKKAKARHGKI 255
                +NN  VD   A+ +  K+
Sbjct: 696 SNGLKVNNHLVDVFYARHQETKV 718


>AL132948-22|CAD31825.2| 1408|Caenorhabditis elegans Hypothetical
            protein Y39B6A.30 protein.
          Length = 1408

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 20/77 (25%), Positives = 33/77 (42%)
 Frame = +1

Query: 175  KVMAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTK 354
            K+ AA E     +  D KK K    KI   ++ V+ +  KSE      E+  +    L  
Sbjct: 989  KIKAAEEERRKERAEDAKKVKEGQEKIAILNAKVQEKEDKSEARRKQKEMDNEAEKLLNV 1048

Query: 355  QRTKERASVSSHLNLSK 405
            ++ KE+  +     +SK
Sbjct: 1049 EKEKEKRKIIEKWIMSK 1065


>AF067619-1|AAC17568.2|  368|Caenorhabditis elegans Hypothetical
           protein K03E5.3 protein.
          Length = 368

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = +2

Query: 104 RQIQTQADHEGLPSLCLR 157
           + I+T  D EG+PS CLR
Sbjct: 74  KMIRTDRDEEGIPSTCLR 91


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,773,274
Number of Sequences: 27780
Number of extensions: 255033
Number of successful extensions: 1006
Number of sequences better than 10.0: 128
Number of HSP's better than 10.0 without gapping: 829
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 992
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1406256614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -