SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U58762-4|AAK39303.1|  109|Caenorhabditis elegans Hypothetical pr...    61   6e-10
Z79600-6|CAB01879.2|  529|Caenorhabditis elegans Hypothetical pr...    29   3.2  
Z79696-1|CAB01972.1| 1584|Caenorhabditis elegans Hypothetical pr...    29   4.2  
Z68004-2|CAA91982.1|  677|Caenorhabditis elegans Hypothetical pr...    28   5.6  
AC024756-9|AAK29883.4|  430|Caenorhabditis elegans Related to ye...    27   9.8  

>U58762-4|AAK39303.1|  109|Caenorhabditis elegans Hypothetical
           protein T27F7.3b protein.
          Length = 109

 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 25/43 (58%), Positives = 32/43 (74%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GT+VEHPEYGEV+QL GDQR+ +  +L K G+V     +VHGF
Sbjct: 67  GTIVEHPEYGEVIQLTGDQRDKVKDFLIKVGIVNESNCRVHGF 109



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/27 (59%), Positives = 23/27 (85%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           T+TTVQG+ +EYDLK+IV+  KK+ +C
Sbjct: 39  TITTVQGIGTEYDLKRIVQYLKKKHSC 65



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 2/41 (4%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKS--SEDDVQDGLVHVRIQQRNGRR 256
           MSI NLN   P ADA +   +ED V+ G+ H+RIQQR GR+
Sbjct: 1   MSIANLNR--P-ADAFEQLETEDGVRQGVCHIRIQQRTGRK 38


>Z79600-6|CAB01879.2|  529|Caenorhabditis elegans Hypothetical
           protein F59C6.8 protein.
          Length = 529

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +2

Query: 125 PTFNRMSIQNLNTFDPF-ADAIKSSEDDVQDGL 220
           PTFNR  I N   FDP+  +A K +   + DGL
Sbjct: 397 PTFNRSKISNPPFFDPYHLNATKRAIYKISDGL 429


>Z79696-1|CAB01972.1| 1584|Caenorhabditis elegans Hypothetical protein
            F54F3.1 protein.
          Length = 1584

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = -2

Query: 388  P*SCSTSPYSGCSTTVPCTRTPSCMPARSSSG 293
            P S +++P  GC  T  C+    C+  RSS+G
Sbjct: 938  PGSSASAPELGCDVTRDCSEFADCVYERSSTG 969


>Z68004-2|CAA91982.1|  677|Caenorhabditis elegans Hypothetical
           protein F47B10.2 protein.
          Length = 677

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = -1

Query: 470 LETVHLELFRLH*AGFGEPLA--NILSLVALKLQHLA 366
           L+ + L L R H  G+GEPLA      L+AL++  LA
Sbjct: 199 LKKLQLNLIRSHATGYGEPLAPNRARMLLALRINILA 235


>AC024756-9|AAK29883.4|  430|Caenorhabditis elegans Related to yeast
           vacuolar proteinsorting factor protein 4 protein.
          Length = 430

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = +3

Query: 297 EEDRAGM-QEGVRVQGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVH 461
           EED AG   + +R+    +E+  +    + QGD++ N  +      L + EQ+K H
Sbjct: 18  EEDTAGRYDQALRLYDQAIEYFLHAIKYESQGDKQRNAIRDKVGQYLNRAEQIKTH 73


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,709,410
Number of Sequences: 27780
Number of extensions: 322335
Number of successful extensions: 879
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 808
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 879
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1613473434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -