SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC006624-8|AAF39782.2| 1092|Caenorhabditis elegans Importin beta...    39   0.003
Z81449-6|CAB03764.2|  489|Caenorhabditis elegans Hypothetical pr...    28   4.8  
Z81449-5|CAB03762.2|  488|Caenorhabditis elegans Hypothetical pr...    28   4.8  
U41625-5|AAA83327.1|  700|Caenorhabditis elegans Suppressor of a...    28   4.8  
AY091467-1|AAM44123.1|  700|Caenorhabditis elegans SUR-5 protein.      28   4.8  
AL023835-5|CAA19490.1|  471|Caenorhabditis elegans Hypothetical ...    28   6.4  
AF099920-2|AAL32226.2|  437|Caenorhabditis elegans Hypothetical ...    28   6.4  
AL032646-5|CAA21682.1| 1798|Caenorhabditis elegans Hypothetical ...    27   8.4  

>AC006624-8|AAF39782.2| 1092|Caenorhabditis elegans Importin beta
           family protein 3 protein.
          Length = 1092

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +1

Query: 34  DVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVCDVVSEL 213
           D R T  V LRR+ +              +  +  ++L  +  +    +++K+ D++SE+
Sbjct: 52  DARSTVLVFLRRVLARDWDAIWETLNEENKQRILAKVLEMIVHETELSIKKKIADLISEI 111

Query: 214 ARNHIDDDGNNQW 252
           A N IDD G+  W
Sbjct: 112 ASNLIDDSGDMTW 124


>Z81449-6|CAB03764.2|  489|Caenorhabditis elegans Hypothetical
           protein C46F11.5b protein.
          Length = 489

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = +1

Query: 205 SELARNHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKL 315
           ++L  NH+DDD N    S  SS  P+P  + +  + L
Sbjct: 407 TDLDENHVDDDDNEDIQSELSSS-PIPEEEFEFERGL 442


>Z81449-5|CAB03762.2|  488|Caenorhabditis elegans Hypothetical
           protein C46F11.5a protein.
          Length = 488

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = +1

Query: 205 SELARNHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKL 315
           ++L  NH+DDD N    S  SS  P+P  + +  + L
Sbjct: 407 TDLDENHVDDDDNEDIQSELSSS-PIPEEEFEFERGL 442


>U41625-5|AAA83327.1|  700|Caenorhabditis elegans Suppressor of
           activated let-60ras protein 5 protein.
          Length = 700

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 4/33 (12%)
 Frame = +3

Query: 444 VKAVGAFILLHDKEPIIQ----KHFRMFFYL*C 530
           V  VG  +L H +E ++Q    KH RMFFY  C
Sbjct: 330 VHTVGGTLLKHIEEHLVQGDSKKHDRMFFYTTC 362


>AY091467-1|AAM44123.1|  700|Caenorhabditis elegans SUR-5 protein.
          Length = 700

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 4/33 (12%)
 Frame = +3

Query: 444 VKAVGAFILLHDKEPIIQ----KHFRMFFYL*C 530
           V  VG  +L H +E ++Q    KH RMFFY  C
Sbjct: 330 VHTVGGTLLKHIEEHLVQGDSKKHDRMFFYTTC 362


>AL023835-5|CAA19490.1|  471|Caenorhabditis elegans Hypothetical
           protein Y37A1B.5 protein.
          Length = 471

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 15/53 (28%), Positives = 27/53 (50%)
 Frame = +1

Query: 193 CDVVSELARNHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKLVLECLRLYQVYL 351
           C V+S +   HI D+ ++   ++ SSC   P  K      L++ CL   ++Y+
Sbjct: 57  CQVISRVDVPHIGDEVHHTGWNACSSCHDKPTEK---RSHLIVPCLNSDRIYI 106


>AF099920-2|AAL32226.2|  437|Caenorhabditis elegans Hypothetical
           protein H06H21.6 protein.
          Length = 437

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 17/57 (29%), Positives = 26/57 (45%)
 Frame = +2

Query: 455 RRLYTTTR*GAHHTKAFQDVLLPLMQVIVLSIEAADDDSALKVLIELADQHLNFSDP 625
           R LYT+   G HH ++  D+L  +   +   I  ADD++   +   L    LN   P
Sbjct: 121 RVLYTSELLGEHHIRSKADLLEDIKNFLSDQISEADDENDKVIAAVLMLYSLNKKHP 177


>AL032646-5|CAA21682.1| 1798|Caenorhabditis elegans Hypothetical
            protein Y54E2A.6 protein.
          Length = 1798

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = +1

Query: 298  QTSKKLVLE-CLRLYQVYLEIVRLKTWM 378
            +T  K VL+ C+R+ Q   E+ RLK W+
Sbjct: 1546 RTDLKSVLDQCIRILQAMREMARLKNWL 1573


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,851,106
Number of Sequences: 27780
Number of extensions: 315339
Number of successful extensions: 770
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 724
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 770
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1395683256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -