SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF068719-7|AAO21425.1|  399|Caenorhabditis elegans Uncoordinated...    69   4e-12
AF068719-6|AAV58864.1|  457|Caenorhabditis elegans Uncoordinated...    69   4e-12
AF068719-5|AAC17781.1|  458|Caenorhabditis elegans Uncoordinated...    69   4e-12
U41540-8|AAW30667.1|  571|Caenorhabditis elegans Hypothetical pr...    30   1.3  
U41540-7|AAM54182.1|  930|Caenorhabditis elegans Hypothetical pr...    30   1.3  
U41540-6|AAM54183.1|  934|Caenorhabditis elegans Hypothetical pr...    30   1.3  
AF039047-10|AAB94229.2|  400|Caenorhabditis elegans Hypothetical...    29   2.9  
Z81556-9|CAB04522.1|   87|Caenorhabditis elegans Hypothetical pr...    29   3.9  
Z50872-7|CAJ55249.1| 1001|Caenorhabditis elegans Hypothetical pr...    29   3.9  
Z50872-6|CAH10768.1| 1039|Caenorhabditis elegans Hypothetical pr...    29   3.9  
AY874872-1|AAX62733.1| 1668|Caenorhabditis elegans chitin syntha...    29   3.9  
AF047655-8|AAC04397.1|  227|Caenorhabditis elegans Hypothetical ...    29   3.9  
AF026210-2|AAB71283.2| 1668|Caenorhabditis elegans Chitin syntha...    29   3.9  
Z68161-7|CAD36488.1| 1130|Caenorhabditis elegans Hypothetical pr...    28   5.1  
Z68161-6|CAA92295.2|  782|Caenorhabditis elegans Hypothetical pr...    28   5.1  
U80027-18|AAC48115.1|  198|Caenorhabditis elegans Hypothetical p...    28   5.1  
AF149286-1|AAF99085.1|  782|Caenorhabditis elegans KRP95 protein.      28   5.1  
AB017106-1|BAA88837.1|  607|Caenorhabditis elegans Kinesin like ...    28   5.1  
Z50016-15|CAA90319.1|  329|Caenorhabditis elegans Hypothetical p...    28   6.8  
AL032621-9|CAA21496.1|  329|Caenorhabditis elegans Hypothetical ...    28   6.8  
AF125951-3|AAY86273.1|  244|Caenorhabditis elegans Hypothetical ...    27   8.9  

>AF068719-7|AAO21425.1|  399|Caenorhabditis elegans Uncoordinated
           protein 23, isoform b protein.
          Length = 399

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 30/84 (35%), Positives = 50/84 (59%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E++VE+LRK    +E EK+ +L +L  I     +  + ECD+++I    DR+  R  TV
Sbjct: 237 IELQVEQLRKKAAELEMEKEQILRSLGEISVHNCMFKLEECDREEIEAITDRLTKRTKTV 296

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           +V V T R+ +Q++AL    + ID
Sbjct: 297 QVVVETPRNEEQKKALEDATLMID 320


>AF068719-6|AAV58864.1|  457|Caenorhabditis elegans Uncoordinated
           protein 23, isoform c protein.
          Length = 457

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 30/84 (35%), Positives = 50/84 (59%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E++VE+LRK    +E EK+ +L +L  I     +  + ECD+++I    DR+  R  TV
Sbjct: 295 IELQVEQLRKKAAELEMEKEQILRSLGEISVHNCMFKLEECDREEIEAITDRLTKRTKTV 354

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           +V V T R+ +Q++AL    + ID
Sbjct: 355 QVVVETPRNEEQKKALEDATLMID 378


>AF068719-5|AAC17781.1|  458|Caenorhabditis elegans Uncoordinated
           protein 23, isoform a protein.
          Length = 458

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 30/84 (35%), Positives = 50/84 (59%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E++VE+LRK    +E EK+ +L +L  I     +  + ECD+++I    DR+  R  TV
Sbjct: 296 IELQVEQLRKKAAELEMEKEQILRSLGEISVHNCMFKLEECDREEIEAITDRLTKRTKTV 355

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           +V V T R+ +Q++AL    + ID
Sbjct: 356 QVVVETPRNEEQKKALEDATLMID 379


>U41540-8|AAW30667.1|  571|Caenorhabditis elegans Hypothetical
           protein F35H12.2c protein.
          Length = 571

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = +2

Query: 227 ERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIK-HSELLLDISECDKDDITRY 403
           ER+ +     +E  + R + +T+R+E E D L   L + K      LD++E   +     
Sbjct: 325 ERENEDPVLRMEKEIGRHQANTLRLERENDDLAHELVTSKIELRRKLDVAEDQIETSANA 384

Query: 404 ADRILSRAMTV-EVTVRTDRDHQQEEALYQ 490
            +R+  + M + E      R+++Q + +Y+
Sbjct: 385 IERLTRQNMDILEENKNLMREYEQIKEMYR 414


>U41540-7|AAM54182.1|  930|Caenorhabditis elegans Hypothetical
           protein F35H12.2a protein.
          Length = 930

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = +2

Query: 227 ERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIK-HSELLLDISECDKDDITRY 403
           ER+ +     +E  + R + +T+R+E E D L   L + K      LD++E   +     
Sbjct: 684 ERENEDPVLRMEKEIGRHQANTLRLERENDDLAHELVTSKIELRRKLDVAEDQIETSANA 743

Query: 404 ADRILSRAMTV-EVTVRTDRDHQQEEALYQ 490
            +R+  + M + E      R+++Q + +Y+
Sbjct: 744 IERLTRQNMDILEENKNLMREYEQIKEMYR 773


>U41540-6|AAM54183.1|  934|Caenorhabditis elegans Hypothetical
           protein F35H12.2b protein.
          Length = 934

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = +2

Query: 227 ERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIK-HSELLLDISECDKDDITRY 403
           ER+ +     +E  + R + +T+R+E E D L   L + K      LD++E   +     
Sbjct: 688 ERENEDPVLRMEKEIGRHQANTLRLERENDDLAHELVTSKIELRRKLDVAEDQIETSANA 747

Query: 404 ADRILSRAMTV-EVTVRTDRDHQQEEALYQ 490
            +R+  + M + E      R+++Q + +Y+
Sbjct: 748 IERLTRQNMDILEENKNLMREYEQIKEMYR 777


>AF039047-10|AAB94229.2|  400|Caenorhabditis elegans Hypothetical
           protein K11D12.9 protein.
          Length = 400

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 3/88 (3%)
 Frame = +2

Query: 218 AGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKH--SELLLDISECDKDD 391
           A  ER+ +   + V+ +   L+     +E EK+  LS +  +K    +   D+ +C KD+
Sbjct: 118 ATLEREKERDRKEVDSQFTILKNRINHLENEKEQCLSEVQELKRLLEDSEQDLKDC-KDE 176

Query: 392 ITRYADRILSRAMTVE-VTVRTDRDHQQ 472
           + R  +  +  A  ++ +T++  R  Q+
Sbjct: 177 MNRLMEERVETADALDKLTIQNYRQQQE 204


>Z81556-9|CAB04522.1|   87|Caenorhabditis elegans Hypothetical
           protein F58G1.9 protein.
          Length = 87

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 317 SLLSTLDSIKHSELLLDISEC 379
           ++LSTLDS+ HSE  L + +C
Sbjct: 16  AILSTLDSLLHSETALSVFDC 36


>Z50872-7|CAJ55249.1| 1001|Caenorhabditis elegans Hypothetical
           protein C05D12.3c protein.
          Length = 1001

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +1

Query: 463 PSAGGSSVSGEHVHR*LVMSVHNDAVSAHS 552
           PS   SSV G  V+R L MS H D ++A++
Sbjct: 246 PSGTDSSVDGVDVYRRLSMSTHGDYLNANN 275


>Z50872-6|CAH10768.1| 1039|Caenorhabditis elegans Hypothetical
           protein C05D12.3a protein.
          Length = 1039

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +1

Query: 463 PSAGGSSVSGEHVHR*LVMSVHNDAVSAHS 552
           PS   SSV G  V+R L MS H D ++A++
Sbjct: 246 PSGTDSSVDGVDVYRRLSMSTHGDYLNANN 275


>AY874872-1|AAX62733.1| 1668|Caenorhabditis elegans chitin synthase 2
            protein.
          Length = 1668

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = +2

Query: 278  LRKDTVR-IEEEKDSLLSTLDSIKHSEL 358
            LRK T+R +E  +DSL  TLD+ K  E+
Sbjct: 1583 LRKGTIRALEHRRDSLFGTLDNRKDDEV 1610


>AF047655-8|AAC04397.1|  227|Caenorhabditis elegans Hypothetical
           protein C17B7.3 protein.
          Length = 227

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = +2

Query: 284 KDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILS-RAMTVEVTVRTDR 460
           KDT   E   D++L  L+  K +E   ++   DKD++  + D   S R+    +      
Sbjct: 55  KDTNCTEGSLDAILCLLNLQKFAERSHELDMNDKDELKGFKDTCDSLRSCLANLKCSPVP 114

Query: 461 DHQQEEALYQVNMYIDS 511
             Q+E AL  +  Y D+
Sbjct: 115 KDQKEAALRSIEKYCDA 131


>AF026210-2|AAB71283.2| 1668|Caenorhabditis elegans Chitin synthase
            protein 2 protein.
          Length = 1668

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = +2

Query: 278  LRKDTVR-IEEEKDSLLSTLDSIKHSEL 358
            LRK T+R +E  +DSL  TLD+ K  E+
Sbjct: 1583 LRKGTIRALEHRRDSLFGTLDNRKDDEV 1610


>Z68161-7|CAD36488.1| 1130|Caenorhabditis elegans Hypothetical
           protein F20C5.2b protein.
          Length = 1130

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +2

Query: 209 SRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKD 388
           SR+   +   D+    +E  +E ++KD   I+ EKD L+  +   KH     D+ E ++ 
Sbjct: 365 SRDGATQSFYDAERAKLEDDIEAIQKDDSLIKHEKDRLIREIQE-KH-----DLLEKERI 418

Query: 389 DITRYADRI 415
           +  R A+RI
Sbjct: 419 EQARVAERI 427


>Z68161-6|CAA92295.2|  782|Caenorhabditis elegans Hypothetical
           protein F20C5.2a protein.
          Length = 782

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +2

Query: 209 SRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKD 388
           SR+   +   D+    +E  +E ++KD   I+ EKD L+  +   KH     D+ E ++ 
Sbjct: 379 SRDGATQSFYDAERAKLEDDIEAIQKDDSLIKHEKDRLIREIQE-KH-----DLLEKERI 432

Query: 389 DITRYADRI 415
           +  R A+RI
Sbjct: 433 EQARVAERI 441


>U80027-18|AAC48115.1|  198|Caenorhabditis elegans Hypothetical
           protein T28A11.3 protein.
          Length = 198

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = +2

Query: 284 KDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILS-RAMTVEVTVRTDR 460
           KDT   E   D++L  L+  K +E   ++   DKD++  + D   S R+    +      
Sbjct: 26  KDTNCTEGSLDAILCLLNLQKFAEKSDELDMNDKDELKGFKDTCDSLRSCLANLKCSPVP 85

Query: 461 DHQQEEALYQVNMYIDS 511
             Q+E AL  +  Y D+
Sbjct: 86  KDQKEAALRSIEKYCDA 102


>AF149286-1|AAF99085.1|  782|Caenorhabditis elegans KRP95 protein.
          Length = 782

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +2

Query: 209 SRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKD 388
           SR+   +   D+    +E  +E ++KD   I+ EKD L+  +   KH     D+ E ++ 
Sbjct: 379 SRDGATQSFYDAERTKLEDDIEAIQKDDSLIKHEKDRLIREIQE-KH-----DLLEKERI 432

Query: 389 DITRYADRI 415
           +  R A+RI
Sbjct: 433 EQARVAERI 441


>AB017106-1|BAA88837.1|  607|Caenorhabditis elegans Kinesin like
           protein (klp-11) protein.
          Length = 607

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +2

Query: 209 SRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKD 388
           SR+   +   D+    +E  +E ++KD   I+ EKD L+  +   KH     D+ E ++ 
Sbjct: 328 SRDGATQSFYDAERAKLEDDIEAIQKDDSLIKHEKDRLIREIQE-KH-----DLLEKERI 381

Query: 389 DITRYADRI 415
           +  R A+RI
Sbjct: 382 EQARVAERI 390


>Z50016-15|CAA90319.1|  329|Caenorhabditis elegans Hypothetical
           protein Y45F3A.1 protein.
          Length = 329

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 22/80 (27%), Positives = 36/80 (45%)
 Frame = +2

Query: 260 EMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVE 439
           + R+E  R+  +RIE+  + L     S K  E  LD     K+ +     R+   +M  E
Sbjct: 13  QRRIEYTRQKVMRIEQMNEQLRKLSKSNKGREEKLDRLLKRKESLELDVARLTDASMRAE 72

Query: 440 VTVRTDRDHQQEEALYQVNM 499
             V  +  H  EE + +V+M
Sbjct: 73  PEVGAELLHSIEEPM-EVDM 91


>AL032621-9|CAA21496.1|  329|Caenorhabditis elegans Hypothetical
           protein Y45F3A.1 protein.
          Length = 329

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 22/80 (27%), Positives = 36/80 (45%)
 Frame = +2

Query: 260 EMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVE 439
           + R+E  R+  +RIE+  + L     S K  E  LD     K+ +     R+   +M  E
Sbjct: 13  QRRIEYTRQKVMRIEQMNEQLRKLSKSNKGREEKLDRLLKRKESLELDVARLTDASMRAE 72

Query: 440 VTVRTDRDHQQEEALYQVNM 499
             V  +  H  EE + +V+M
Sbjct: 73  PEVGAELLHSIEEPM-EVDM 91


>AF125951-3|AAY86273.1|  244|Caenorhabditis elegans Hypothetical
           protein D2063.4 protein.
          Length = 244

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +3

Query: 498 CTSIAGDVRAQRRSECAFPLPDLYERV-HVSAGPQRGHDKNFETAI 632
           CT +AGDV  +  ++ A P+ ++Y+RV HV       ++ N  + I
Sbjct: 85  CTHVAGDVVIENLTDIAIPI-EVYKRVRHVHGSIIIANNTNISSPI 129


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,266,838
Number of Sequences: 27780
Number of extensions: 332738
Number of successful extensions: 1045
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 973
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1045
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1476380920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -