SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U70852-1|AAK29815.1| 2361|Caenorhabditis elegans Hypothetical pr...    32   0.47 
Z81476-2|CAB03918.1| 1469|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z50795-1|CAA90662.1|  502|Caenorhabditis elegans Hypothetical pr...    28   5.8  
U97196-11|AAB52464.1|  273|Caenorhabditis elegans Hypothetical p...    28   7.6  

>U70852-1|AAK29815.1| 2361|Caenorhabditis elegans Hypothetical protein
            F45E4.4 protein.
          Length = 2361

 Score = 31.9 bits (69), Expect = 0.47
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = -1

Query: 313  GHVDRTIGVPHGRTEYSPAGLTDD 242
            GH+D+ I +P G T + PAG+ ++
Sbjct: 1638 GHIDQPISLPRGHTGFKPAGIVNE 1661


>Z81476-2|CAB03918.1| 1469|Caenorhabditis elegans Hypothetical protein
            C25F9.2 protein.
          Length = 1469

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 10/101 (9%)
 Frame = +3

Query: 21   LTPKTTTNKLRVRKGR---SVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRG 191
            +TPK  + K+    G    +V  + +  NYG   I NH ++A+ +       T +P L+G
Sbjct: 1352 MTPKVYSLKMEDVNGELDYTVKAKGMTLNYGNAQIINHTSMAERMHDFNTKGTSEP-LQG 1410

Query: 192  ----LKACTNLRWSDFTVQPKSSVKP---AGEYSVRPCGTP 293
                 K   N+    +T   K ++ P    G Y+     TP
Sbjct: 1411 EMFTFKRGDNMLDGLYTYTTKKNLNPRMDKGHYNTEGVVTP 1451


>Z50795-1|CAA90662.1|  502|Caenorhabditis elegans Hypothetical
           protein R166.1 protein.
          Length = 502

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -2

Query: 519 TLAMLCKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSV-MAFRLS 379
           +L  L ++S+ A   +T      +S SSP+  L T S NSV +AF+ S
Sbjct: 121 SLRFLSQLSSVAEKVSTPSEAADTSSSSPSLNLNTTSSNSVPLAFKFS 168


>U97196-11|AAB52464.1|  273|Caenorhabditis elegans Hypothetical
           protein B0207.11 protein.
          Length = 273

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 20/73 (27%), Positives = 35/73 (47%)
 Frame = +2

Query: 329 EQMASQIVCQQSVQPQTLSLNAITEFCDLVPRQQFGEDGDDLVQATIVVLAQAQVDTLQS 508
           E+  ++IV ++  +P+ +SLN + E C    +   G+   D+ +    VL    VD  QS
Sbjct: 45  EEKDNKIVSRE--KPEMMSLNTLVEMCSAGEKPTKGKSEKDIRKKKAPVL----VDDNQS 98

Query: 509 MAKVFAPSKLFRP 547
              +  PS+   P
Sbjct: 99  YVMIGPPSEPVEP 111


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,242,513
Number of Sequences: 27780
Number of extensions: 369631
Number of successful extensions: 1184
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1112
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1184
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1666201324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -