SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U40427-5|AAP82652.1|  356|Caenorhabditis elegans Abnormal cell m...    29   2.0  
U40427-4|AAA81470.2|  362|Caenorhabditis elegans Abnormal cell m...    29   2.0  
AF150958-1|AAD43178.1|  362|Caenorhabditis elegans guidance prot...    29   2.0  
L14433-6|AAA27974.2| 2107|Caenorhabditis elegans Hypothetical pr...    28   4.7  

>U40427-5|AAP82652.1|  356|Caenorhabditis elegans Abnormal cell
           migration protein13, isoform b protein.
          Length = 356

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +1

Query: 328 TSKMSVFKILLSSIIHIHVCQFIMFILC 411
           T+   VF +L S+ I + +C FIMF+ C
Sbjct: 227 TTVSGVFVLLFSATIILSLCGFIMFVCC 254


>U40427-4|AAA81470.2|  362|Caenorhabditis elegans Abnormal cell
           migration protein13, isoform a protein.
          Length = 362

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +1

Query: 328 TSKMSVFKILLSSIIHIHVCQFIMFILC 411
           T+   VF +L S+ I + +C FIMF+ C
Sbjct: 233 TTVSGVFVLLFSATIILSLCGFIMFVCC 260


>AF150958-1|AAD43178.1|  362|Caenorhabditis elegans guidance protein
           MIG-13 protein.
          Length = 362

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +1

Query: 328 TSKMSVFKILLSSIIHIHVCQFIMFILC 411
           T+   VF +L S+ I + +C FIMF+ C
Sbjct: 233 TTVSGVFVLLFSATIILSLCGFIMFVCC 260


>L14433-6|AAA27974.2| 2107|Caenorhabditis elegans Hypothetical
           protein C50C3.2 protein.
          Length = 2107

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 14/45 (31%), Positives = 21/45 (46%)
 Frame = -2

Query: 501 TQTVLSTINIDATVIHFCKTLVLCTSPRPLA*DKHNKLTNMYMYN 367
           T  V  T+N+  T  H+   L +C S +     K  +L N+Y  N
Sbjct: 611 TDIVSETVNLRRTTTHYQHLLSICASYKKSIDSKLEELANVYTDN 655


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,677,746
Number of Sequences: 27780
Number of extensions: 238966
Number of successful extensions: 616
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 598
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 616
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1353389824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -