SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U23139-7|AAK31492.1|  929|Caenorhabditis elegans Hypothetical pr...    29   2.4  
U58732-7|AAB00597.1|  345|Caenorhabditis elegans Taf (tbp-associ...    29   3.1  
U23179-2|AAK68207.1|  345|Caenorhabditis elegans Serpentine rece...    29   4.1  
AF106581-5|AAC78210.1|  588|Caenorhabditis elegans Hypothetical ...    29   4.1  
U29380-18|ABB88224.1|  733|Caenorhabditis elegans Zygote defecti...    28   7.2  
U29380-17|AAA68733.3|  736|Caenorhabditis elegans Zygote defecti...    28   7.2  
U29380-16|AAS60254.1|  761|Caenorhabditis elegans Zygote defecti...    28   7.2  
U29380-15|AAS60253.1|  777|Caenorhabditis elegans Zygote defecti...    28   7.2  
AY487140-1|AAR32790.1|  733|Caenorhabditis elegans centrosome at...    28   7.2  
Z83238-5|CAB05796.1|  304|Caenorhabditis elegans Hypothetical pr...    27   9.6  
Z50176-2|CAA90539.1| 1115|Caenorhabditis elegans Hypothetical pr...    27   9.6  

>U23139-7|AAK31492.1|  929|Caenorhabditis elegans Hypothetical
           protein F13H8.2 protein.
          Length = 929

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 460 NTVSWALRLCLTTNSKLDENCIGNGIELRHREDL 561
           NTV W      TT++ ++ + +GN  +L HRED+
Sbjct: 379 NTVHWVKMSIETTSNSVECDSVGNLDKLGHREDV 412


>U58732-7|AAB00597.1|  345|Caenorhabditis elegans Taf
           (tbp-associated transcriptionfactor) family protein 11.1
           protein.
          Length = 345

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = +3

Query: 330 KENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYS 467
           +ENE   ++T + LS   +   E  + Y    FQ  T+RR+  +Y+
Sbjct: 227 EENELSRLKTQVLLSNFSQEQLERYESYRRSSFQKSTIRRLISQYT 272


>U23179-2|AAK68207.1|  345|Caenorhabditis elegans Serpentine
           receptor, class b (beta)protein 5 protein.
          Length = 345

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = -1

Query: 541 IRFHSRYSSHQAWNLSSGRAATPS*LYFL 455
           I +H  Y   Q W LS    A PS LYFL
Sbjct: 15  ISYHPIYRLAQFWTLSVSLLAVPSLLYFL 43


>AF106581-5|AAC78210.1|  588|Caenorhabditis elegans Hypothetical
           protein VC5.2 protein.
          Length = 588

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 12/44 (27%), Positives = 20/44 (45%)
 Frame = +2

Query: 554 KICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           K   Y NES  ++        +    QD E+++H W ++H   G
Sbjct: 236 KFMKYCNESLLEIIGRDNFATLEEMVQDSEQVEHIWNKYHQIIG 279


>U29380-18|ABB88224.1|  733|Caenorhabditis elegans Zygote defective:
           embryonic lethalprotein 12, isoform d protein.
          Length = 733

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +3

Query: 267 ATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEK 386
           AT L+K +A + E EY S    E+   S+Q   E+  + +
Sbjct: 621 ATALQKAKAVIDELEYNSRPVSEDSMTSVQAFKEMKEENE 660


>U29380-17|AAA68733.3|  736|Caenorhabditis elegans Zygote defective:
           embryonic lethalprotein 12, isoform a protein.
          Length = 736

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +3

Query: 267 ATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEK 386
           AT L+K +A + E EY S    E+   S+Q   E+  + +
Sbjct: 624 ATALQKAKAVIDELEYNSRPVSEDSMTSVQAFKEMKEENE 663


>U29380-16|AAS60254.1|  761|Caenorhabditis elegans Zygote defective:
           embryonic lethalprotein 12, isoform c protein.
          Length = 761

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +3

Query: 267 ATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEK 386
           AT L+K +A + E EY S    E+   S+Q   E+  + +
Sbjct: 624 ATALQKAKAVIDELEYNSRPVSEDSMTSVQAFKEMKEENE 663


>U29380-15|AAS60253.1|  777|Caenorhabditis elegans Zygote defective:
           embryonic lethalprotein 12, isoform b protein.
          Length = 777

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +3

Query: 267 ATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEK 386
           AT L+K +A + E EY S    E+   S+Q   E+  + +
Sbjct: 624 ATALQKAKAVIDELEYNSRPVSEDSMTSVQAFKEMKEENE 663


>AY487140-1|AAR32790.1|  733|Caenorhabditis elegans centrosome
           attachment protein A protein.
          Length = 733

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +3

Query: 267 ATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEK 386
           AT L+K +A + E EY S    E+   S+Q   E+  + +
Sbjct: 621 ATALQKAKAVIDELEYNSRPVSEDSMTSVQAFKEMKEENE 660


>Z83238-5|CAB05796.1|  304|Caenorhabditis elegans Hypothetical
           protein T08G3.6 protein.
          Length = 304

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 20/67 (29%), Positives = 27/67 (40%), Gaps = 2/67 (2%)
 Frame = +2

Query: 416 VAGLPGFHVA*NVQEIQSAGRCGSA*RQIPSLMRTVSGMESNY--ATAKICSYKNESKCD 589
           V+G P  +   N    Q     GSA RQI  ++R   G    Y    +K C Y  +  C 
Sbjct: 50  VSGAPRRNALQNAGPAQKICTPGSACRQISLIVRVCKGDTYRYILCNSKTCVYPAQRTCC 109

Query: 590 LSLEPEI 610
           +   P I
Sbjct: 110 IPYVPMI 116


>Z50176-2|CAA90539.1| 1115|Caenorhabditis elegans Hypothetical protein
            C09G1.2 protein.
          Length = 1115

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +3

Query: 267  ATGLRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLR 446
            AT   +  +S +E + T+ + K+ EE + +  L L + E+A+ E+T +   +DF  FT++
Sbjct: 867  ATDTDQRSSSCSELKGTT-MNKKQEENT-RKRLSL-KNEEASPEKTLVRAEKDFNHFTVK 923

Query: 447  RMFKKYS-QLGVAALPDDK 500
            +  +  S   G  ALP  K
Sbjct: 924  KKEECLSLSFGFIALPIKK 942


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,293,230
Number of Sequences: 27780
Number of extensions: 303255
Number of successful extensions: 1014
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 967
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1014
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1581836700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -