SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20071
         (462 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z73899-6|CAA98078.1|  345|Caenorhabditis elegans Hypothetical pr...    30   0.93 
Z81454-8|CAD60404.1|  330|Caenorhabditis elegans Hypothetical pr...    27   6.5  
Z73912-8|CAA98148.1| 1016|Caenorhabditis elegans Hypothetical pr...    27   6.5  
Z72517-7|CAA96698.1| 1016|Caenorhabditis elegans Hypothetical pr...    27   6.5  
Z50796-1|CAA90668.1|  490|Caenorhabditis elegans Hypothetical pr...    27   6.5  

>Z73899-6|CAA98078.1|  345|Caenorhabditis elegans Hypothetical
           protein ZK829.8 protein.
          Length = 345

 Score = 29.9 bits (64), Expect = 0.93
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = -2

Query: 110 QNIYLSLKVLTYQSYIPSLHNS*LDILLKRSLFP 9
           Q I+LSLK  T+   +  LH+S L  L+ +++ P
Sbjct: 221 QKIHLSLKACTFSGAVKRLHSSLLKSLIAQTIIP 254


>Z81454-8|CAD60404.1|  330|Caenorhabditis elegans Hypothetical
           protein B0391.12 protein.
          Length = 330

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 17/49 (34%), Positives = 24/49 (48%)
 Frame = +2

Query: 122 AYAHLAGACLASNFLYFVLILNVQYVHPLLVFRHLNKMFLLLEIHLLSG 268
           AY  L G  LA   ++FV    V    PL+   H+ K+ LL+   +L G
Sbjct: 91  AYCSLFGMSLAIFAIHFVYRHLVVEKSPLIFQNHVRKILLLILFTILIG 139


>Z73912-8|CAA98148.1| 1016|Caenorhabditis elegans Hypothetical
           protein ZK524.4 protein.
          Length = 1016

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +2

Query: 50  YEVMEYKTDKSRLLDLNKYFVN*GAYAHLAGACLASNFLYFVLILN-VQYVHPLLV 214
           YEV++ +T    +L+L  Y ++     H  G C +    YF  I+  + Y H L V
Sbjct: 90  YEVLDTQTKIFLILELGDYDLHDFIIKHEKGVCESLAQQYFCQIMTAIDYCHQLHV 145


>Z72517-7|CAA96698.1| 1016|Caenorhabditis elegans Hypothetical
           protein ZK524.4 protein.
          Length = 1016

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +2

Query: 50  YEVMEYKTDKSRLLDLNKYFVN*GAYAHLAGACLASNFLYFVLILN-VQYVHPLLV 214
           YEV++ +T    +L+L  Y ++     H  G C +    YF  I+  + Y H L V
Sbjct: 90  YEVLDTQTKIFLILELGDYDLHDFIIKHEKGVCESLAQQYFCQIMTAIDYCHQLHV 145


>Z50796-1|CAA90668.1|  490|Caenorhabditis elegans Hypothetical
           protein T05A6.4 protein.
          Length = 490

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 14/57 (24%), Positives = 26/57 (45%)
 Frame = +2

Query: 155 SNFLYFVLILNVQYVHPLLVFRHLNKMFLLLEIHLLSGQKISLCQNKFL*SA*HFYC 325
           S+  +  +I+N++ +HP     H   M+ LL+    S     LCQ  ++      +C
Sbjct: 289 SSSQWLPVIINLENLHPDFCLTHSEVMWFLLKKISFSNIHSKLCQTPYIPKGLDTFC 345


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,217,018
Number of Sequences: 27780
Number of extensions: 176558
Number of successful extensions: 311
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 306
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 311
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 818426686
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -