SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL034393-3|CAA22319.1|  348|Caenorhabditis elegans Hypothetical ...    79   3e-15
U28928-9|AAN63431.1|  471|Caenorhabditis elegans Hypothetical pr...    28   6.5  
Z70756-1|CAA94789.1| 1295|Caenorhabditis elegans Hypothetical pr...    27   8.6  

>AL034393-3|CAA22319.1|  348|Caenorhabditis elegans Hypothetical
           protein Y18D10A.3 protein.
          Length = 348

 Score = 79.0 bits (186), Expect = 3e-15
 Identities = 37/67 (55%), Positives = 48/67 (71%)
 Frame = +2

Query: 308 YLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGG 487
           ++ Q  AA +D+ LFT+Y F V+QLMELAGL+ A AIA  +P    S+  ++CGPGNNGG
Sbjct: 125 FIGQKLAAQIDEQLFTKYGFKVEQLMELAGLAAAQAIAAHYP---KSNVAVLCGPGNNGG 181

Query: 488 DGLVAAR 508
           DG V AR
Sbjct: 182 DGFVCAR 188



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           ++Q FG+  S+ YPK +   L ++L+ QC   ++ I   LP
Sbjct: 189 HLQQFGFTPSIVYPKESRNELMKSLVVQCETSSIPITATLP 229


>U28928-9|AAN63431.1|  471|Caenorhabditis elegans Hypothetical
           protein C44B7.10 protein.
          Length = 471

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +1

Query: 523 GYNVSVHYPKRTPKPLYENLLEQCIRFNVNII 618
           G NV VH    TP PL ++L E  +  N+N I
Sbjct: 53  GDNVFVHGIAATPTPLLQSLSEHAVANNLNKI 84


>Z70756-1|CAA94789.1| 1295|Caenorhabditis elegans Hypothetical protein
            T06E4.1 protein.
          Length = 1295

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = +2

Query: 224  ECSNIACSKTDNIGTMTSSMNQCNTVTRYLNQSEAAA 334
            E SN+  ++  N+GT+T S++Q     + +N+   A+
Sbjct: 1086 EASNVWKTQAMNVGTLTESLSQLQVQLQQMNEKLVAS 1122


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,411,989
Number of Sequences: 27780
Number of extensions: 310972
Number of successful extensions: 713
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 699
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 712
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1416829972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -