SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock prot...   154   6e-38
AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock pr...   153   1e-37
M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C. el...   151   5e-37
Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical pr...   128   4e-30
M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein ( C.ele...   128   4e-30
Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical pr...   124   5e-29
Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical pr...   123   9e-29
Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical pr...   123   9e-29
X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.        97   7e-21
U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock prot...    97   7e-21
Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical p...    85   3e-17
Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical pr...    85   3e-17
Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical pr...    74   1e-13
L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical pr...    67   1e-11
U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical pr...    38   0.005
Z70035-12|CAB76726.1|  150|Caenorhabditis elegans Hypothetical p...    31   0.91 
AF100655-8|ABO16452.1|  470|Caenorhabditis elegans Hypothetical ...    30   1.2  
AF100655-6|ABO16453.1|  470|Caenorhabditis elegans Hypothetical ...    30   1.2  
AF100655-4|ABO16447.1|  470|Caenorhabditis elegans Hypothetical ...    30   1.2  
AF045643-2|AAC02596.2|  663|Caenorhabditis elegans Hypothetical ...    30   1.2  
Z73974-1|CAA98270.2|  349|Caenorhabditis elegans Hypothetical pr...    29   2.1  
M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical pr...    28   6.4  
M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical pr...    28   6.4  
AF047663-8|AAK84581.1|  114|Caenorhabditis elegans Hypothetical ...    28   6.4  
U21324-16|AAK93841.1|  169|Caenorhabditis elegans Arp2/3 complex...    27   8.5  

>U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock protein
           protein 3 protein.
          Length = 661

 Score =  154 bits (373), Expect = 6e-38
 Identities = 72/106 (67%), Positives = 88/106 (83%), Gaps = 1/106 (0%)
 Frame = +2

Query: 245 RQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQD-GERLIG 421
           + E+K+   GT+IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAF+ D G+RLIG
Sbjct: 24  KTEKKETKYGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIG 83

Query: 422 DAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRT 559
           DAAKNQLT NPENT+FDAKRLIGR+++D+     +   P + + ++
Sbjct: 84  DAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKS 129



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 24/43 (55%), Positives = 34/43 (79%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PFKV++K++KP V+V+    +K F PEE+SAMVL
Sbjct: 113 TVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVL 155


>AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock
           protein protein 4 protein.
          Length = 657

 Score =  153 bits (370), Expect = 1e-37
 Identities = 74/117 (63%), Positives = 92/117 (78%), Gaps = 1/117 (0%)
 Frame = +2

Query: 254 EKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQD-GERLIGDAA 430
           EK++ +GT+IGIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAF+ D GERLIGDAA
Sbjct: 24  EKEEKMGTIIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSGDQGERLIGDAA 83

Query: 431 KNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATK 601
           KNQLT NPENT+FDAKRLIGR ++++     +   P + + ++     + K+   TK
Sbjct: 84  KNQLTINPENTIFDAKRLIGRFYNEKTVQQDIKHWPFKIVDKSNKPNVEVKVGSETK 140



 Score = 57.6 bits (133), Expect = 7e-09
 Identities = 24/43 (55%), Positives = 34/43 (79%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PFK+V+K++KP+V+V+     K F PEE+SAMVL
Sbjct: 110 TVQQDIKHWPFKIVDKSNKPNVEVKVGSETKQFTPEEVSAMVL 152


>M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C.
           elegans BiP (hsp3)gene, complete cds. ).
          Length = 661

 Score =  151 bits (365), Expect = 5e-37
 Identities = 71/106 (66%), Positives = 87/106 (82%), Gaps = 1/106 (0%)
 Frame = +2

Query: 245 RQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQD-GERLIG 421
           + E+K+    T+IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAF+ D G+RLIG
Sbjct: 24  KTEKKETKYETIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIG 83

Query: 422 DAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRT 559
           DAAKNQLT NPENT+FDAKRLIGR+++D+     +   P + + ++
Sbjct: 84  DAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKS 129



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 24/43 (55%), Positives = 34/43 (79%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PFKV++K++KP V+V+    +K F PEE+SAMVL
Sbjct: 113 TVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVL 155


>Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical
           protein F26D10.3 protein.
          Length = 640

 Score =  128 bits (308), Expect = 4e-30
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+ +G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP N
Sbjct: 7   VGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPHN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFDD 80



 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PFKV+  + +KP VQV+    +K+F PEEIS+MVL
Sbjct: 81  PAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVL 125


>M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein (
           C.elegans heat shockprotein 70A gene, complete cds. ).
          Length = 640

 Score =  128 bits (308), Expect = 4e-30
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+ +G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP N
Sbjct: 7   VGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPHN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFDD 80



 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PFKV+  + +KP VQV+    +K+F PEEIS+MVL
Sbjct: 81  PAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVL 125


>Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical
           protein C12C8.1 protein.
          Length = 643

 Score =  124 bits (299), Expect = 5e-29
 Identities = 56/76 (73%), Positives = 67/76 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVG+Y+NG+VEI+AN +GN+ TPSYVAFT D ERL+GDAAK+Q   NPEN
Sbjct: 7   IGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFT-DTERLVGDAAKDQAARNPEN 65

Query: 461 TVFDAKRLIGREWSDQ 508
           TVFDAKRLIGR + ++
Sbjct: 66  TVFDAKRLIGRRFDEE 81



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 22/43 (51%), Positives = 27/43 (62%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PF V  K  KP V+V+     + F  EEISAMVL
Sbjct: 82  TVQSDIKHWPFTVKGKQGKPVVEVEVKGEKREFNAEEISAMVL 124


>Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.5 protein.
          Length = 645

 Score =  123 bits (297), Expect = 9e-29
 Identities = 56/75 (74%), Positives = 66/75 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVG+Y+NG+VEI+AN +GN+ TPSYVAFT D ERL+GDAAK+Q   NPEN
Sbjct: 7   IGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFT-DTERLVGDAAKDQAARNPEN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR + +
Sbjct: 66  TVFDAKRLIGRRFDE 80



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 22/43 (51%), Positives = 27/43 (62%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D K +PF V  K  KP ++V+     + F PEEISAMVL
Sbjct: 82  TVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVL 124


>Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.4 protein.
          Length = 645

 Score =  123 bits (297), Expect = 9e-29
 Identities = 56/75 (74%), Positives = 66/75 (88%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVG+Y+NG+VEI+AN +GN+ TPSYVAFT D ERL+GDAAK+Q   NPEN
Sbjct: 7   IGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFT-DTERLVGDAAKDQAARNPEN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR + +
Sbjct: 66  TVFDAKRLIGRRFDE 80



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 22/43 (51%), Positives = 27/43 (62%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D K +PF V  K  KP ++V+     + F PEEISAMVL
Sbjct: 82  TVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVL 124


>X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.
          Length = 487

 Score = 97.5 bits (232), Expect = 7e-21
 Identities = 52/109 (47%), Positives = 63/109 (57%)
 Frame = +2

Query: 227 RGRLCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDG 406
           R  L   +   DK  G VIGIDLGTT SCV + +    ++I N +G R TPS VAFT DG
Sbjct: 16  RSSLMSARSLSDKPKGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADG 75

Query: 407 ERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           ERL+G  AK Q  TN  NT+F  KRLIGR + D      L   P + +K
Sbjct: 76  ERLVGAPAKRQAVTNSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVK 124



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +1

Query: 499 E*PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           E P VQ D+K  P+K+V K S     V+ +QG K + P ++ A VL
Sbjct: 107 EDPEVQKDLKVVPYKIV-KASNGDAWVE-AQG-KEYPPSQVGAFVL 149


>U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock protein
           protein 6 protein.
          Length = 657

 Score = 97.5 bits (232), Expect = 7e-21
 Identities = 52/109 (47%), Positives = 63/109 (57%)
 Frame = +2

Query: 227 RGRLCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDG 406
           R  L   +   DK  G VIGIDLGTT SCV + +    ++I N +G R TPS VAFT DG
Sbjct: 16  RSSLMSARSLSDKPKGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADG 75

Query: 407 ERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           ERL+G  AK Q  TN  NT+F  KRLIGR + D      L   P + +K
Sbjct: 76  ERLVGAPAKRQAVTNSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVK 124



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 20/46 (43%), Positives = 29/46 (63%)
 Frame = +1

Query: 499 E*PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           E P VQ D+K  P+K+V K S     V+ +QG KV++P ++ A VL
Sbjct: 107 EDPEVQKDLKVVPYKIV-KASNGDAWVE-AQG-KVYSPSQVGAFVL 149


>Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 85.4 bits (202), Expect = 3e-17
 Identities = 46/109 (42%), Positives = 68/109 (62%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTT+SCV  Y+NG+V I+ N+ G R TPS +A  +DG+ LIG  AK+ +     N
Sbjct: 3   IGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKD-VIGKATN 61

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYL 607
           ++FD KR+IGR + D L    +   P + +++  N +   ++HK  K L
Sbjct: 62  SLFDVKRIIGRRYDDVLLQRDMPLWPFK-VEKDDNGIPYLEIHKNEKPL 109


>Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 85.4 bits (202), Expect = 3e-17
 Identities = 46/109 (42%), Positives = 68/109 (62%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTT+SCV  Y+NG+V I+ N+ G R TPS +A  +DG+ LIG  AK+ +     N
Sbjct: 3   IGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKD-VIGKATN 61

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYL 607
           ++FD KR+IGR + D L    +   P + +++  N +   ++HK  K L
Sbjct: 62  SLFDVKRIIGRRYDDVLLQRDMPLWPFK-VEKDDNGIPYLEIHKNEKPL 109


>Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical
           protein F54C9.2 protein.
          Length = 450

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 36/76 (47%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYK--NGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           + GIDLGTTYS +G+Y    G   I+ +D G +  PS VAF  +G  LIG  A  Q   N
Sbjct: 35  IAGIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIGTRATEQQEHN 94

Query: 452 PENTVFDAKRLIGREW 499
           P+ T++DAKR IGR +
Sbjct: 95  PKRTIYDAKRFIGRNF 110


>L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical
           protein C30C11.4 protein.
          Length = 776

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 34/93 (36%), Positives = 55/93 (59%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D+G     +GV + G +E+I ND     TP+ V+F    +R +G AA+  +TTN 
Sbjct: 2   SVLGFDIGNLNCYIGVARQGGIEVITNDYSLHATPACVSFGPK-DRSMGVAARQAVTTNI 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           +NTV + K LIGR++SD +    +   P + +K
Sbjct: 61  KNTVINFKHLIGRKFSDPVAQRFIPFIPCKVVK 93


>U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical
           protein T24H7.2 protein.
          Length = 925

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +2

Query: 287 IDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENT 463
           IDLGT +  +G+ K G  ++I  N +  R TP+ V   QDG R   DAA       P   
Sbjct: 29  IDLGTQFLKIGIVKPGIPMDIALNTESRRKTPN-VVMIQDGHRTFADAAIGMQVRYPHLV 87

Query: 464 VFDAKRLIGR 493
                 L+G+
Sbjct: 88  HGQLNDLVGK 97


>Z70035-12|CAB76726.1|  150|Caenorhabditis elegans Hypothetical
           protein R09D1.14 protein.
          Length = 150

 Score = 30.7 bits (66), Expect = 0.91
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)
 Frame = +2

Query: 296 GTTYSCVGVYKNGRVEIIANDQGNRITPSYVAF---TQDGE-RLIGDAAKNQLT 445
           G     +G Y   +  +I +DQ + +T +  AF   T DG+ ++ GD AKN+ T
Sbjct: 40  GCNKRIIGYYFATQTSVITSDQVSNLTHAVFAFVNITSDGQLQIDGDLAKNRFT 93


>AF100655-8|ABO16452.1|  470|Caenorhabditis elegans Hypothetical
           protein C44C8.8 protein.
          Length = 470

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 2/97 (2%)
 Frame = +2

Query: 332 GRVEIIANDQGNRITPSYVAFTQDGERLIG-DAAKNQLTTNPENTVFDAKRLIGREWSD- 505
           GRVE+   D+       Y+     G R +  +    +L  +P+    + K     +  + 
Sbjct: 175 GRVEVFNYDRKMHEALKYLLGKLFGGRTVKVNRFAIELDEDPDEIFVNLKEFKDIDRPEL 234

Query: 506 QLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYLLLK 616
             Y+++L++ PSR      +L  + KLH+ATKYLL K
Sbjct: 235 SSYHILLTARPSRE-----DLSNERKLHEATKYLLKK 266


>AF100655-6|ABO16453.1|  470|Caenorhabditis elegans Hypothetical
           protein C44C8.9 protein.
          Length = 470

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 2/97 (2%)
 Frame = +2

Query: 332 GRVEIIANDQGNRITPSYVAFTQDGERLIG-DAAKNQLTTNPENTVFDAKRLIGREWSD- 505
           GRVE+   D+       Y+     G R +  +    +L  +P+    + K     +  + 
Sbjct: 175 GRVEVFNYDRKMHEALKYLLGKLFGGRTVKVNRFAIELDEDPDEIFVNLKEFKDIDRPEL 234

Query: 506 QLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYLLLK 616
             Y+++L++ PSR      +L  + KLH+ATKYLL K
Sbjct: 235 SSYHILLTARPSRE-----DLSNERKLHEATKYLLKK 266


>AF100655-4|ABO16447.1|  470|Caenorhabditis elegans Hypothetical
           protein C44C8.10 protein.
          Length = 470

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 2/97 (2%)
 Frame = +2

Query: 332 GRVEIIANDQGNRITPSYVAFTQDGERLIG-DAAKNQLTTNPENTVFDAKRLIGREWSD- 505
           GRVE+   D+       Y+     G R +  +    +L  +P+    + K     +  + 
Sbjct: 175 GRVEVFNYDRKMHEALKYLLGKLFGGRTVKVNRFAIELDEDPDEIFVNLKEFKDIDRPEL 234

Query: 506 QLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYLLLK 616
             Y+++L++ PSR      +L  + KLH+ATKYLL K
Sbjct: 235 SSYHILLTARPSRE-----DLSNERKLHEATKYLLKK 266


>AF045643-2|AAC02596.2|  663|Caenorhabditis elegans Hypothetical
           protein F58H7.7 protein.
          Length = 663

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 2/97 (2%)
 Frame = +2

Query: 332 GRVEIIANDQGNRITPSYVAFTQDGERLIG-DAAKNQLTTNPENTVFDAKRLIGREWSD- 505
           GRVE+   D+       Y+     G R +  +    +L  +P+    + K     +  + 
Sbjct: 175 GRVEVFNYDRKMHEALKYLLGKLFGGRTVKVNRFAIELDEDPDEIFVNLKEFKDIDRPEL 234

Query: 506 QLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYLLLK 616
             Y+++L++ PSR      +L  + KLH+ATKYLL K
Sbjct: 235 SSYHILLTARPSRE-----DLSNERKLHEATKYLLKK 266


>Z73974-1|CAA98270.2|  349|Caenorhabditis elegans Hypothetical
           protein F29F11.3 protein.
          Length = 349

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +2

Query: 5   TRRRELSRVFLEQLNEKYRCTV*IRKCLIKAF*SDL 112
           T R+EL RV  E+  +K  C++ I KC++     DL
Sbjct: 173 TYRKELERVLKEKCLQKIACSMGILKCMVPDHADDL 208


>M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical
           protein ZK370.4b protein.
          Length = 1353

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 10/38 (26%), Positives = 22/38 (57%)
 Frame = +2

Query: 434 NQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRS 547
           N + +   + +  A+R+  R+W+ +LY  ++  SP R+
Sbjct: 112 NMVNSASGSNLSGARRMRKRDWAKKLYKSLVQDSPGRT 149


>M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical
           protein ZK370.4a protein.
          Length = 1342

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 10/38 (26%), Positives = 22/38 (57%)
 Frame = +2

Query: 434 NQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRS 547
           N + +   + +  A+R+  R+W+ +LY  ++  SP R+
Sbjct: 112 NMVNSASGSNLSGARRMRKRDWAKKLYKSLVQDSPGRT 149


>AF047663-8|AAK84581.1|  114|Caenorhabditis elegans Hypothetical
           protein W09G12.5 protein.
          Length = 114

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = +2

Query: 398 QDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDQL--YNMMLSSSPSRSLK 553
           QD E L+ + AK      P+  +F  + L+G E  DQL  +N  L++  S   K
Sbjct: 2   QDNEPLMRELAKLIRVNEPDLVLFVGEALVGNEAVDQLVKFNEALANHASPGQK 55


>U21324-16|AAK93841.1|  169|Caenorhabditis elegans Arp2/3 complex
           component protein 6 protein.
          Length = 169

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 11/20 (55%), Positives = 17/20 (85%)
 Frame = +1

Query: 532 FPFKVVEKNSKPHVQVQTSQ 591
           F  +VVE+++KP V+VQTS+
Sbjct: 25  FSSQVVERHNKPEVEVQTSK 44


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,932,021
Number of Sequences: 27780
Number of extensions: 321900
Number of successful extensions: 756
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 717
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 742
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1406256614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -