SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20067
         (619 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79598-2|CAB01864.1|  738|Caenorhabditis elegans Hypothetical pr...    31   0.66 
Z69792-5|CAA93668.3| 1410|Caenorhabditis elegans Hypothetical pr...    30   1.2  
AL022270-3|CAB63434.2| 1410|Caenorhabditis elegans Hypothetical ...    30   1.2  
Z79598-3|CAB01865.1|  680|Caenorhabditis elegans Hypothetical pr...    27   8.1  
Z66565-4|CAA91480.1|  384|Caenorhabditis elegans Hypothetical pr...    27   8.1  
AJ242473-1|CAB43345.1|  680|Caenorhabditis elegans SYM-1 protein...    27   8.1  
AF025460-5|AAB70988.5|  584|Caenorhabditis elegans Polh (dna pol...    27   8.1  
AC084197-41|AAG23462.3|  493|Caenorhabditis elegans Ligand-gated...    27   8.1  
AB244413-1|BAE72703.1|  584|Caenorhabditis elegans DNA polymeras...    27   8.1  

>Z79598-2|CAB01864.1|  738|Caenorhabditis elegans Hypothetical
           protein C44H4.2 protein.
          Length = 738

 Score = 31.1 bits (67), Expect = 0.66
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + FP ++ LY +NL +N + S+H  TF
Sbjct: 118 EIFPNLNKLYDINLGSNKIFSIHTSTF 144


>Z69792-5|CAA93668.3| 1410|Caenorhabditis elegans Hypothetical
           protein F40E10.4 protein.
          Length = 1410

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I P+ F G+H+L+ + L  NN+  L  +TF
Sbjct: 326 IQPKAFLGLHNLHTLVLYGNNITDLKSDTF 355


>AL022270-3|CAB63434.2| 1410|Caenorhabditis elegans Hypothetical
           protein F40E10.4 protein.
          Length = 1410

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I P+ F G+H+L+ + L  NN+  L  +TF
Sbjct: 326 IQPKAFLGLHNLHTLVLYGNNITDLKSDTF 355


>Z79598-3|CAB01865.1|  680|Caenorhabditis elegans Hypothetical
           protein C44H4.3 protein.
          Length = 680

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           +S Q   G   L  V+LSNNN++ +H  +F
Sbjct: 339 VSQQTLKGAPFLRMVSLSNNNIREVHELSF 368


>Z66565-4|CAA91480.1|  384|Caenorhabditis elegans Hypothetical
           protein T04F8.4 protein.
          Length = 384

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/41 (31%), Positives = 18/41 (43%)
 Frame = -3

Query: 428 NMKSSRLIG*RGSAFSTTRSRISSPNFCVPISRKLHLACLY 306
           NM   R+I   G  FST       P F   + +  H+ C+Y
Sbjct: 93  NMDRQRMIAPEGMMFSTVLIISFHPLFLTRMDKAYHIRCMY 133


>AJ242473-1|CAB43345.1|  680|Caenorhabditis elegans SYM-1 protein
           protein.
          Length = 680

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           +S Q   G   L  V+LSNNN++ +H  +F
Sbjct: 339 VSQQTLKGAPFLRMVSLSNNNIREVHELSF 368


>AF025460-5|AAB70988.5|  584|Caenorhabditis elegans Polh (dna
           polymerase eta) homologprotein 1 protein.
          Length = 584

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = +3

Query: 435 TRTSPGCYCKNREQHDWLY 491
           TR  PG   +NR  H+WLY
Sbjct: 426 TRFQPGIPAQNRSIHEWLY 444


>AC084197-41|AAG23462.3|  493|Caenorhabditis elegans Ligand-gated
           ion channel protein 10 protein.
          Length = 493

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%)
 Frame = -1

Query: 385 FRPRDQGYHRRTFVYRFRGSCTWLVC--IPEIQSICSLWD 272
           +R R     R    YRF   C  L+   +PEIQSIC + +
Sbjct: 386 YRKRRSTVFRGVHNYRFNQECDDLMYSKVPEIQSICMMME 425


>AB244413-1|BAE72703.1|  584|Caenorhabditis elegans DNA polymerase
           eta protein.
          Length = 584

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = +3

Query: 435 TRTSPGCYCKNREQHDWLY 491
           TR  PG   +NR  H+WLY
Sbjct: 426 TRFQPGIPAQNRSIHEWLY 444


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,543,932
Number of Sequences: 27780
Number of extensions: 273678
Number of successful extensions: 812
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 812
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1342816466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -