SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF016447-13|AAG24017.1|  334|Caenorhabditis elegans Serpentine r...    29   2.8  
AF016686-11|AAB66235.1|  205|Caenorhabditis elegans Hypothetical...    29   3.8  
U40415-3|AAK39250.1|  110|Caenorhabditis elegans Fmrf-like pepti...    28   5.0  
AF042397-1|AAC08948.1|  110|Caenorhabditis elegans FMRFamide-lik...    28   5.0  
AC006832-1|AAO38581.1|  376|Caenorhabditis elegans Hypothetical ...    28   5.0  
U97008-7|AAB52313.1|  385|Caenorhabditis elegans Temporarily ass...    27   8.7  

>AF016447-13|AAG24017.1|  334|Caenorhabditis elegans Serpentine
           receptor, class h protein268 protein.
          Length = 334

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -2

Query: 600 LFYIDFDLHLITLTCHIYEGSFIFHI 523
           +F I FDL  ITL C I  G F+  +
Sbjct: 179 IFVISFDLRTITLPCMIIAGFFVVEV 204


>AF016686-11|AAB66235.1|  205|Caenorhabditis elegans Hypothetical
           protein R07C3.5 protein.
          Length = 205

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = -2

Query: 576 HLITLTCHIYEGSFIFHIESLQKIFSSASFYFKRRQNLQKG-YHHPLENSSI 424
           +L+T T  IY G     +++L  IF  +SF  K  + L    + HP+   S+
Sbjct: 33  NLVTDTLEIYTGDLRKTLDTLSSIFHPSSFPLKSLRILDNADFKHPIIQGSL 84


>U40415-3|AAK39250.1|  110|Caenorhabditis elegans Fmrf-like peptide
           protein 11, isoforma protein.
          Length = 110

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +3

Query: 9   APQPVPALGRAGRQDHVHG*L*TPRQKVNTLRN 107
           APQP    GR+G+ DH+H  L T  QK+    N
Sbjct: 78  APQPFVRFGRSGQLDHMHDLLST-LQKLKFANN 109


>AF042397-1|AAC08948.1|  110|Caenorhabditis elegans FMRFamide-like
           peptide 11a protein.
          Length = 110

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +3

Query: 9   APQPVPALGRAGRQDHVHG*L*TPRQKVNTLRN 107
           APQP    GR+G+ DH+H  L T  QK+    N
Sbjct: 78  APQPFVRFGRSGQLDHMHDLLST-LQKLKFANN 109


>AC006832-1|AAO38581.1|  376|Caenorhabditis elegans Hypothetical
           protein ZK355.2b protein.
          Length = 376

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 2/72 (2%)
 Frame = -3

Query: 446 IHWKILQSIFFVQNNYKSSFQSHTSNEVKIVD--SHRALARCVERCDVCCHMTLTCTNCY 273
           I+   L+SIF V   Y++    H S +V   +   +R L  C+    +      T   C 
Sbjct: 23  IYEYFLESIFSVSPAYENETADHNSTDVLCANCIGNRNLIACIRSSVIAVLGICTAAMCM 82

Query: 272 ALICAVRT*SAS 237
           A I  + T S S
Sbjct: 83  ARIAKLHTTSQS 94


>U97008-7|AAB52313.1|  385|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 293 protein.
          Length = 385

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/76 (22%), Positives = 35/76 (46%)
 Frame = -3

Query: 551 YTKDLLSFTLNHYKKYFHLLHSILNEGKIYKKAIIIHWKILQSIFFVQNNYKSSFQSHTS 372
           Y   +L F  N Y+K+  L  +     +  K+ ++++ KIL++ FF      +      S
Sbjct: 69  YCPMVLLFASNIYEKFIFLRGNARFTPETCKRFVLLYRKILKTHFFNDKFIYTVIIFTQS 128

Query: 371 NEVKIVDSHRALARCV 324
           + +++ D    L  C+
Sbjct: 129 SSLRLSDMFGLLVSCI 144


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,538,541
Number of Sequences: 27780
Number of extensions: 313335
Number of successful extensions: 800
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 770
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 800
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1434198608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -