SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z93381-3|CAB07606.1|  362|Caenorhabditis elegans Hypothetical pr...    29   3.3  
Z79639-2|CAB01915.1|  367|Caenorhabditis elegans Hypothetical pr...    29   4.4  

>Z93381-3|CAB07606.1|  362|Caenorhabditis elegans Hypothetical
           protein F28G4.3 protein.
          Length = 362

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +2

Query: 494 NKLQ*LVIYIHSFYSLRDTSPFMYYTISISTL 589
           N L   +I IHSFY L  T  ++ Y+++++ L
Sbjct: 115 NHLNQAMISIHSFYKLNPTGRYILYSLNLTEL 146


>Z79639-2|CAB01915.1|  367|Caenorhabditis elegans Hypothetical
           protein F54E4.2 protein.
          Length = 367

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 5/55 (9%)
 Frame = +3

Query: 267 LWEQQWH---PCAIVGSMTIMYLLIWLLDLNTLASIAI--VGLILNFVDFMVPVI 416
           LW   WH   PC IV  ++ MYLL+ +   N    + I     + N VD  +  +
Sbjct: 134 LWRSPWHMVIPCFIVAIISNMYLLVAVKQENFQCILIIDEYSTLYNSVDVFISTL 188


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,358,354
Number of Sequences: 27780
Number of extensions: 335466
Number of successful extensions: 851
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 812
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 851
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1666201324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -