SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024780-6|AAF60569.1|  259|Caenorhabditis elegans Ribosomal pro...   126   2e-29
U97189-1|AAC48164.1|  623|Caenorhabditis elegans Hypothetical pr...    30   1.8  
Z81521-3|CAB04225.1|  353|Caenorhabditis elegans Hypothetical pr...    29   4.1  
U23450-8|AAK31471.1|  350|Caenorhabditis elegans Hypothetical pr...    28   7.1  
AF300704-1|AAG24400.1|  622|Caenorhabditis elegans incenp-like p...    28   7.1  
AC025716-5|AAK39616.1|  622|Caenorhabditis elegans Incenp homolo...    28   7.1  
AC024792-1|AAK84610.1|  938|Caenorhabditis elegans Importin beta...    27   9.4  

>AC024780-6|AAF60569.1|  259|Caenorhabditis elegans Ribosomal
           protein, small subunitprotein 4 protein.
          Length = 259

 Score =  126 bits (303), Expect = 2e-29
 Identities = 65/135 (48%), Positives = 80/135 (59%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRT   +P GFMDVV+IE+TNE FR++YD KGR+ +HRI   EA +KLCKVK V T 
Sbjct: 72  DGKVRTCHKFPTGFMDVVAIERTNEYFRMLYDTKGRYVVHRIQAAEADFKLCKVKSVRTV 131

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
            K VP L T DGRTIRYPDP +KV       +  +++  S    PG           G  
Sbjct: 132 NKGVPVLTTTDGRTIRYPDPHVKVNDTIVFNISTQKITDSVKFEPGNLAYVTGGRNVGRV 191

Query: 615 APSCSRERHPGSSTL 659
                RER PG+S +
Sbjct: 192 GIIGHRERLPGASDI 206



 Score =  112 bits (270), Expect = 2e-25
 Identities = 52/73 (71%), Positives = 59/73 (80%)
 Frame = +1

Query: 46  RGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVL 225
           RGPKKHLKRL AP  WMLDKLGGV+A RP+ GPHKLRE LPL +FLRNRLKYAL   E  
Sbjct: 2   RGPKKHLKRLAAPSHWMLDKLGGVFAVRPNPGPHKLRESLPLSLFLRNRLKYALNYTEAK 61

Query: 226 KIVKQRLIKVMGK 264
           KI+ QR+++V GK
Sbjct: 62  KILTQRVVRVDGK 74



 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 31/62 (50%), Positives = 39/62 (62%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+I  +I+T KI D +KFE GNL  +TGGRN+GRVG I          DI+HIK
Sbjct: 151 PHVKVNDTIVFNISTQKITDSVKFEPGNLAYVTGGRNVGRVGIIGHRERLPGASDIIHIK 210

Query: 671 DS 676
           DS
Sbjct: 211 DS 212


>U97189-1|AAC48164.1|  623|Caenorhabditis elegans Hypothetical
           protein C48B6.4 protein.
          Length = 623

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +3

Query: 357 GRFTIHRITPEEAKYKLCKVKRVATGPKNVP-----YLVTHDGRTIR-YP 488
           G+  + R+T  E  Y+ CK+++ A   K VP     Y+V H  R I+ YP
Sbjct: 302 GQIIVRRLTDPEYPYRHCKIQKFAVRCKLVPENYGWYVVWHCQRDIQEYP 351


>Z81521-3|CAB04225.1|  353|Caenorhabditis elegans Hypothetical
           protein F32A11.3 protein.
          Length = 353

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 2/57 (3%)
 Frame = +3

Query: 126 ETVNRSPQVARVLAPGDFPEESSEVCFDRKRSPENCETTP--HKGDGKVRTDPTYPA 290
           + V + P+VA  +    + +E S  CF RK+  E  E  P  H         PTY A
Sbjct: 145 QQVQQKPKVAPKMLHKMYDDEESGYCFARKKDVEQEEEVPEIHVAAPVTTPIPTYSA 201


>U23450-8|AAK31471.1|  350|Caenorhabditis elegans Hypothetical
           protein C30B5.7 protein.
          Length = 350

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +3

Query: 189 SSEVCFDRKRSPENCETTPHKGDGKVRTDPT 281
           S E+   +K+SP+ CE TP +G  K  T  T
Sbjct: 320 SEEMSLSKKQSPDGCE-TPLRGSAKALTART 349


>AF300704-1|AAG24400.1|  622|Caenorhabditis elegans incenp-like
           protein ICP-1 protein.
          Length = 622

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = +3

Query: 159 VLAPGDFPEESSEVCFDRKRSPENCETTPHKGDGKVRTD 275
           VL PG    E  E+   +K  P    ++ H+GD  + TD
Sbjct: 73  VLKPGRIDAEFVELISRQKAKPAQPSSSSHRGDDDMETD 111


>AC025716-5|AAK39616.1|  622|Caenorhabditis elegans Incenp homolog
           protein 1 protein.
          Length = 622

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = +3

Query: 159 VLAPGDFPEESSEVCFDRKRSPENCETTPHKGDGKVRTD 275
           VL PG    E  E+   +K  P    ++ H+GD  + TD
Sbjct: 73  VLKPGRIDAEFVELISRQKAKPAQPSSSSHRGDDDMETD 111


>AC024792-1|AAK84610.1|  938|Caenorhabditis elegans Importin beta
            family protein 5 protein.
          Length = 938

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 14/42 (33%), Positives = 18/42 (42%)
 Frame = -3

Query: 475  VRPSCVTKYGTFLGPVATRLTLHNLYLASSGVIRWIVNLPLT 350
            V P C   Y     PVA  +  H  Y A + ++R   N P T
Sbjct: 880  VNPFCRLSYAPKQPPVAANIANHKAYFAQAVLVRGPGNCPET 921


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,308,478
Number of Sequences: 27780
Number of extensions: 382703
Number of successful extensions: 981
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 933
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 981
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1550199966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -