SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79596-2|CAC42251.1|  838|Caenorhabditis elegans Hypothetical pr...   149   1e-36
Z79596-1|CAB01857.1|  830|Caenorhabditis elegans Hypothetical pr...   149   1e-36
L29031-1|AAB72228.2|  830|Caenorhabditis elegans dynamin protein.     149   1e-36
AF167982-1|AAD50438.1|  838|Caenorhabditis elegans dynamin protein.   149   1e-36
U61944-2|AAL56621.1|  705|Caenorhabditis elegans Dynamin related...   105   2e-23
U61944-1|AAL56622.1|  712|Caenorhabditis elegans Dynamin related...   105   2e-23
AF166274-1|AAD49861.1|  705|Caenorhabditis elegans dynamin-relat...   105   2e-23
Z47808-7|CAA87771.2|  934|Caenorhabditis elegans Hypothetical pr...    48   4e-06
Z75549-1|CAA99917.1|  424|Caenorhabditis elegans Hypothetical pr...    30   1.6  
AF068709-17|AAC19257.2|  287|Caenorhabditis elegans Serpentine r...    27   8.5  

>Z79596-2|CAC42251.1|  838|Caenorhabditis elegans Hypothetical
           protein C02C6.1b protein.
          Length = 838

 Score =  149 bits (362), Expect = 1e-36
 Identities = 71/89 (79%), Positives = 80/89 (89%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ MI  FI RE+CLILAVTPAN+DLA SDALKLAKEVDPQGLRTIGV+TKLDLMDEG
Sbjct: 156 QQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG 215

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDAR++LENKL  LRRGY+GVVNR +K +
Sbjct: 216 TDAREILENKLFTLRRGYVGVVNRGQKDI 244



 Score =  135 bits (327), Expect = 2e-32
 Identities = 64/81 (79%), Positives = 68/81 (83%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI    EYAEFLH KG +F DF+ VR EIE ETDRVTG NKGISP PINLRV+SPNVLN
Sbjct: 74  QLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLN 133

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKVP+GDQP DI
Sbjct: 134 LTLIDLPGLTKVPVGDQPADI 154



 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 31/36 (86%), Positives = 33/36 (91%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI GRKDI AAL AERKFF+SHPSYRH+ADRLGT
Sbjct: 241 QKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGT 276


>Z79596-1|CAB01857.1|  830|Caenorhabditis elegans Hypothetical
           protein C02C6.1a protein.
          Length = 830

 Score =  149 bits (362), Expect = 1e-36
 Identities = 71/89 (79%), Positives = 80/89 (89%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ MI  FI RE+CLILAVTPAN+DLA SDALKLAKEVDPQGLRTIGV+TKLDLMDEG
Sbjct: 156 QQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG 215

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDAR++LENKL  LRRGY+GVVNR +K +
Sbjct: 216 TDAREILENKLFTLRRGYVGVVNRGQKDI 244



 Score =  135 bits (327), Expect = 2e-32
 Identities = 64/81 (79%), Positives = 68/81 (83%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI    EYAEFLH KG +F DF+ VR EIE ETDRVTG NKGISP PINLRV+SPNVLN
Sbjct: 74  QLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLN 133

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKVP+GDQP DI
Sbjct: 134 LTLIDLPGLTKVPVGDQPADI 154



 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 31/36 (86%), Positives = 33/36 (91%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI GRKDI AAL AERKFF+SHPSYRH+ADRLGT
Sbjct: 241 QKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGT 276


>L29031-1|AAB72228.2|  830|Caenorhabditis elegans dynamin protein.
          Length = 830

 Score =  149 bits (362), Expect = 1e-36
 Identities = 71/89 (79%), Positives = 80/89 (89%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ MI  FI RE+CLILAVTPAN+DLA SDALKLAKEVDPQGLRTIGV+TKLDLMDEG
Sbjct: 156 QQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG 215

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDAR++LENKL  LRRGY+GVVNR +K +
Sbjct: 216 TDAREILENKLFTLRRGYVGVVNRGQKDI 244



 Score =  135 bits (327), Expect = 2e-32
 Identities = 64/81 (79%), Positives = 68/81 (83%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI    EYAEFLH KG +F DF+ VR EIE ETDRVTG NKGISP PINLRV+SPNVLN
Sbjct: 74  QLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLN 133

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKVP+GDQP DI
Sbjct: 134 LTLIDLPGLTKVPVGDQPADI 154



 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 31/36 (86%), Positives = 33/36 (91%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI GRKDI AAL AERKFF+SHPSYRH+ADRLGT
Sbjct: 241 QKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGT 276


>AF167982-1|AAD50438.1|  838|Caenorhabditis elegans dynamin protein.
          Length = 838

 Score =  149 bits (362), Expect = 1e-36
 Identities = 71/89 (79%), Positives = 80/89 (89%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ MI  FI RE+CLILAVTPAN+DLA SDALKLAKEVDPQGLRTIGV+TKLDLMDEG
Sbjct: 156 QQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG 215

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDAR++LENKL  LRRGY+GVVNR +K +
Sbjct: 216 TDAREILENKLFTLRRGYVGVVNRGQKDI 244



 Score =  135 bits (327), Expect = 2e-32
 Identities = 64/81 (79%), Positives = 68/81 (83%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI    EYAEFLH KG +F DF+ VR EIE ETDRVTG NKGISP PINLRV+SPNVLN
Sbjct: 74  QLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLN 133

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPGLTKVP+GDQP DI
Sbjct: 134 LTLIDLPGLTKVPVGDQPADI 154



 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 31/36 (86%), Positives = 33/36 (91%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI GRKDI AAL AERKFF+SHPSYRH+ADRLGT
Sbjct: 241 QKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGT 276


>U61944-2|AAL56621.1|  705|Caenorhabditis elegans Dynamin related
           protein protein1, isoform a protein.
          Length = 705

 Score =  105 bits (253), Expect = 2e-23
 Identities = 50/89 (56%), Positives = 67/89 (75%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI+ MI  +I   S +ILAVTPAN D A S+ +KLA+EVD  G RT+ V+TKLDLMD+G
Sbjct: 166 EQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQG 225

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDA DVL  K++P++ G IGVVNR ++ +
Sbjct: 226 TDAMDVLMGKVIPVKLGIIGVVNRSQQNI 254



 Score =  102 bits (244), Expect = 2e-22
 Identities = 45/74 (60%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           ++A F H   K FTDF+ VR EIE ETDRVTG NKGIS +PI+L++YS  V++L+L+DLP
Sbjct: 91  DWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLP 150

Query: 212 GLTKVPIGDQPIDI 253
           G+TK+P+GDQP++I
Sbjct: 151 GITKIPVGDQPVNI 164


>U61944-1|AAL56622.1|  712|Caenorhabditis elegans Dynamin related
           protein protein1, isoform b protein.
          Length = 712

 Score =  105 bits (253), Expect = 2e-23
 Identities = 50/89 (56%), Positives = 67/89 (75%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI+ MI  +I   S +ILAVTPAN D A S+ +KLA+EVD  G RT+ V+TKLDLMD+G
Sbjct: 166 EQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQG 225

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDA DVL  K++P++ G IGVVNR ++ +
Sbjct: 226 TDAMDVLMGKVIPVKLGIIGVVNRSQQNI 254



 Score =  102 bits (244), Expect = 2e-22
 Identities = 45/74 (60%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           ++A F H   K FTDF+ VR EIE ETDRVTG NKGIS +PI+L++YS  V++L+L+DLP
Sbjct: 91  DWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLP 150

Query: 212 GLTKVPIGDQPIDI 253
           G+TK+P+GDQP++I
Sbjct: 151 GITKIPVGDQPVNI 164


>AF166274-1|AAD49861.1|  705|Caenorhabditis elegans dynamin-related
           protein protein.
          Length = 705

 Score =  105 bits (253), Expect = 2e-23
 Identities = 50/89 (56%), Positives = 67/89 (75%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI+ MI  +I   S +ILAVTPAN D A S+ +KLA+EVD  G RT+ V+TKLDLMD+G
Sbjct: 166 EQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQG 225

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDA DVL  K++P++ G IGVVNR ++ +
Sbjct: 226 TDAMDVLMGKVIPVKLGIIGVVNRSQQNI 254



 Score =  102 bits (244), Expect = 2e-22
 Identities = 45/74 (60%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           ++A F H   K FTDF+ VR EIE ETDRVTG NKGIS +PI+L++YS  V++L+L+DLP
Sbjct: 91  DWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLP 150

Query: 212 GLTKVPIGDQPIDI 253
           G+TK+P+GDQP++I
Sbjct: 151 GITKIPVGDQPVNI 164


>Z47808-7|CAA87771.2|  934|Caenorhabditis elegans Hypothetical
           protein D2013.5 protein.
          Length = 934

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 5/73 (6%)
 Frame = +1

Query: 298 SCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD----VLENK 465
           + +IL +   + D   S+   L   +DP G RTI V+TK+D+ ++     D    +LE K
Sbjct: 429 NAIILCIQDGSVDAERSNVTDLVSSIDPSGKRTILVLTKVDMAEKNLANPDRIKKILEGK 488

Query: 466 LLPLRR-GYIGVV 501
           L P++  GY GVV
Sbjct: 489 LFPMKALGYFGVV 501



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 19/58 (32%), Positives = 27/58 (46%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGD 238
           K TD  ++R E E          K +S   I+L V  PN+  + L+DLPG+      D
Sbjct: 351 KETDLQQLRNETEVRMRNSVRDGKTVSNEVISLTVKGPNLPRMVLVDLPGVISTVTAD 408


>Z75549-1|CAA99917.1|  424|Caenorhabditis elegans Hypothetical
           protein T19C4.1 protein.
          Length = 424

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = -1

Query: 401 PIVRNPCGSTSLASFRASLLA-KSVLAGVTARIRHDSRLMNWNIIPLICC 255
           P + +P   + + +F   +L  K     VTA++   +  +NWN+I ++CC
Sbjct: 216 PSMGHPVPLSQMGAFVPPMLEQKPSPRAVTAQLAIRTPYLNWNMISIVCC 265


>AF068709-17|AAC19257.2|  287|Caenorhabditis elegans Serpentine
           receptor, class x protein24 protein.
          Length = 287

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 10/41 (24%), Positives = 20/41 (48%)
 Frame = -1

Query: 368 LASFRASLLAKSVLAGVTARIRHDSRLMNWNIIPLICCRYL 246
           LA+++   L++++L      +    R   WN +   CC+ L
Sbjct: 189 LAAYKGRKLSRALLGAAGLEVSEVQRKREWNFVKQTCCQGL 229


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,150,814
Number of Sequences: 27780
Number of extensions: 278236
Number of successful extensions: 840
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 840
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1406256614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -