SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L15188-7|AAA27951.1|  161|Caenorhabditis elegans Ribosomal prote...    95   2e-20
Z83244-6|CAD18877.1|  502|Caenorhabditis elegans Hypothetical pr...    30   1.2  
Z83244-5|CAB54315.1|  568|Caenorhabditis elegans Hypothetical pr...    30   1.2  
Z83244-4|CAB54314.1|  562|Caenorhabditis elegans Hypothetical pr...    30   1.2  
U00047-4|AAA50690.1|  825|Caenorhabditis elegans Hypothetical pr...    29   1.6  
AL132853-5|CAB60443.1|  279|Caenorhabditis elegans Hypothetical ...    29   2.1  
Z83241-2|CAB05816.2|  435|Caenorhabditis elegans Hypothetical pr...    29   2.7  
Z46267-9|CAA86427.2|  889|Caenorhabditis elegans Hypothetical pr...    29   2.7  
Z78016-1|CAB01439.1|  276|Caenorhabditis elegans Hypothetical pr...    28   3.6  
AF106592-4|AAK21366.1|  786|Caenorhabditis elegans Hypothetical ...    28   4.8  
AF039719-10|AAB96751.2|  568|Caenorhabditis elegans Hypothetical...    28   4.8  
Z92775-2|CAB07162.2|  382|Caenorhabditis elegans Hypothetical pr...    27   6.3  
Z92775-1|CAB07161.2|  379|Caenorhabditis elegans Hypothetical pr...    27   6.3  
U00065-10|AAA50733.2|  382|Caenorhabditis elegans Hypothetical p...    27   6.3  
AC084197-45|AAK68589.4|  751|Caenorhabditis elegans Hypothetical...    27   6.3  
AC006769-14|AAF60579.1|  378|Caenorhabditis elegans Hypothetical...    27   6.3  
AL110490-7|CAD59175.1|  533|Caenorhabditis elegans Hypothetical ...    27   8.4  
AL110490-6|CAB54442.2|  687|Caenorhabditis elegans Hypothetical ...    27   8.4  

>L15188-7|AAA27951.1|  161|Caenorhabditis elegans Ribosomal protein,
           large subunitprotein 21 protein.
          Length = 161

 Score = 95.5 bits (227), Expect = 2e-20
 Identities = 47/84 (55%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTV-NLKRQPAPPK 430
           +RVRG I+PKRINIR+EH+K SKCR DFL RVK N+   K AK+AG+ V  LKR P  P+
Sbjct: 78  KRVRGNILPKRINIRIEHIKPSKCRTDFLNRVKSNDEKRKAAKSAGQPVPALKRLPVAPR 137

Query: 431 AAH-IVSGTEKPVLLAPIPYEFVA 499
            AH + +   +P LLAP+ +E VA
Sbjct: 138 GAHTVTTQNNEPELLAPLRFEIVA 161



 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 40/73 (54%), Positives = 50/73 (68%)
 Frame = +3

Query: 36  QGLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 215
           +GL    + +    FR HG   LSTY   YK GD+VDI+ NGA QKGMP K YHG+TGR+
Sbjct: 5   KGLRRGTRYMFARDFRKHGVEHLSTYYTQYKRGDLVDIKTNGAFQKGMPFKAYHGRTGRI 64

Query: 216 YNVTAHALGVIVN 254
           +NVT  A+G+IVN
Sbjct: 65  FNVTRGAVGIIVN 77



 Score = 27.5 bits (58), Expect = 6.3
 Identities = 12/17 (70%), Positives = 13/17 (76%)
 Frame = +1

Query: 25 MTNSKGYXXGTRDLFAR 75
          MTNSKG   GTR +FAR
Sbjct: 1  MTNSKGLRRGTRYMFAR 17


>Z83244-6|CAD18877.1|  502|Caenorhabditis elegans Hypothetical
           protein W06F12.2c protein.
          Length = 502

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = -2

Query: 208 PVFPWYTLCGIPF*TAPLPLMSTMSPTLYTFMYVESGIVPCVRN 77
           PVFP Y+  G+P    PLP     +P     M V+  + P V+N
Sbjct: 226 PVFPSYSRAGVPQTPIPLPPTQINTPYPIDPMEVQFTVQPKVKN 269


>Z83244-5|CAB54315.1|  568|Caenorhabditis elegans Hypothetical
           protein W06F12.2b protein.
          Length = 568

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = -2

Query: 208 PVFPWYTLCGIPF*TAPLPLMSTMSPTLYTFMYVESGIVPCVRN 77
           PVFP Y+  G+P    PLP     +P     M V+  + P V+N
Sbjct: 226 PVFPSYSRAGVPQTPIPLPPTQINTPYPIDPMEVQFTVQPKVKN 269


>Z83244-4|CAB54314.1|  562|Caenorhabditis elegans Hypothetical
           protein W06F12.2a protein.
          Length = 562

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = -2

Query: 208 PVFPWYTLCGIPF*TAPLPLMSTMSPTLYTFMYVESGIVPCVRN 77
           PVFP Y+  G+P    PLP     +P     M V+  + P V+N
Sbjct: 220 PVFPSYSRAGVPQTPIPLPPTQINTPYPIDPMEVQFTVQPKVKN 263


>U00047-4|AAA50690.1|  825|Caenorhabditis elegans Hypothetical
           protein ZK418.6 protein.
          Length = 825

 Score = 29.5 bits (63), Expect = 1.6
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +2

Query: 401 NLKRQPAPPKAAHIVSGTE 457
           NL+R+PAPPK  H+ S  E
Sbjct: 462 NLRRRPAPPKQNHVASPAE 480


>AL132853-5|CAB60443.1|  279|Caenorhabditis elegans Hypothetical
           protein Y80D3A.9 protein.
          Length = 279

 Score = 29.1 bits (62), Expect = 2.1
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -2

Query: 466 DGFLSSTDDVGSFRGSWLSLQVDGLAGSL 380
           DG LS  D+    RG+WL +   G  G L
Sbjct: 39  DGMLSGVDEKDVARGTWLGMDAHGKVGML 67


>Z83241-2|CAB05816.2|  435|Caenorhabditis elegans Hypothetical
           protein T25C8.1 protein.
          Length = 435

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = +3

Query: 24  DDELQGLPXRHQGLVRSQFRTHGTIPLSTYMKVYKV 131
           DD LQ L   HQG++R+ F     IPL   +K+ +V
Sbjct: 358 DDPLQLLEATHQGIIRNLFELF-PIPLLKSLKIRRV 392


>Z46267-9|CAA86427.2|  889|Caenorhabditis elegans Hypothetical
           protein F49E2.5d protein.
          Length = 889

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +2

Query: 299 VEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVN-LKRQPAPPKAAHIVSGTEKPVLLA 475
           VE+V          +  K+N++  K++++   T   ++  PAPP+   +V   EKPV  A
Sbjct: 361 VENVVEKSTTPPATENKKKNKKDKKKSESEKVTEQPVESAPAPPQVEQVVEKVEKPV--A 418

Query: 476 PI 481
           P+
Sbjct: 419 PV 420


>Z78016-1|CAB01439.1|  276|Caenorhabditis elegans Hypothetical
           protein R186.1 protein.
          Length = 276

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = -2

Query: 466 DGFLSSTDDVGSFRGSWLSLQVDGLAGSL 380
           DG LS  D   + RG+WL L  +G  G +
Sbjct: 39  DGILSGVDKQENARGTWLGLNENGRIGMM 67


>AF106592-4|AAK21366.1|  786|Caenorhabditis elegans Hypothetical
           protein D1037.1 protein.
          Length = 786

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 3/120 (2%)
 Frame = +2

Query: 107 HVHESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQRVRGRIIPK- 283
           H H+S +S +  R  + W SS+         + RSR     S SR   Q+R R R   K 
Sbjct: 53  HRHKSKKSKKVRRRSKTWSSSRS--------RSRSR-----SRSRGRSQERRRSRKSRKS 99

Query: 284 RINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAA--GKTVNLKRQPAPPKAAHIVSGTE 457
           R   R++H +  K  +  L++  +NE L+ +A +   GK    K  P   +A  +  G +
Sbjct: 100 RSRSRLKH-REEKIEKKNLEKAPKNE-LIPQAPSTENGKPKEFKEPPRKDEADDLPLGAD 157


>AF039719-10|AAB96751.2|  568|Caenorhabditis elegans Hypothetical
           protein K04F10.2 protein.
          Length = 568

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 62  TCSLAVPHTWNYSALHVHESV 124
           TC LA+   WNY+A  VH  +
Sbjct: 124 TCKLALIRFWNYNASRVHAQI 144


>Z92775-2|CAB07162.2|  382|Caenorhabditis elegans Hypothetical
           protein C06H5.2 protein.
          Length = 382

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -2

Query: 361 LILFDSLKEVLSALGVL 311
           LILFD+LK VL ++GVL
Sbjct: 200 LILFDALKNVLQSVGVL 216


>Z92775-1|CAB07161.2|  379|Caenorhabditis elegans Hypothetical
           protein C06H5.1 protein.
          Length = 379

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -2

Query: 361 LILFDSLKEVLSALGVL 311
           LILFD+LK VL ++GVL
Sbjct: 200 LILFDALKNVLQSVGVL 216


>U00065-10|AAA50733.2|  382|Caenorhabditis elegans Hypothetical
           protein D1044.1 protein.
          Length = 382

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
 Frame = +2

Query: 182 TQSIPWKDRSRVQRDCSCSRCDCQQRVR-GRIIPKRINIRVEHVKHSKCRQDFLKRVKEN 358
           +  IPWK+   V  D +  R      +   ++ P  ++ R++ VKH+          K+N
Sbjct: 177 SDEIPWKNYENVLYDAAYIRMLHNDTLDFEKLCPAELSGRIQEVKHAFDEDGVRNSEKKN 236

Query: 359 ERL 367
           E+L
Sbjct: 237 EKL 239


>AC084197-45|AAK68589.4|  751|Caenorhabditis elegans Hypothetical
           protein Y73B6BL.1 protein.
          Length = 751

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 14/38 (36%), Positives = 17/38 (44%)
 Frame = +2

Query: 125 QSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCS 238
           Q  RHC  Q   C S  Y      W+ RSRV    +C+
Sbjct: 366 QPVRHCSEQDATCDSPFYWCDMKLWRCRSRVVYGGNCT 403


>AC006769-14|AAF60579.1|  378|Caenorhabditis elegans Hypothetical
           protein Y45G12C.1 protein.
          Length = 378

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -2

Query: 319 GVLDMLNT-DIDALRYNPSANTLLTITPRA*AVTLYTRPVFPWYTLCGI 176
           G+LD   T DID L+ N  +  L  +     A T +T  +  W+TLC +
Sbjct: 272 GLLDYFPTFDIDDLKSNEKSLQLSAMLVYL-ARTQFTLDILKWHTLCAL 319


>AL110490-7|CAD59175.1|  533|Caenorhabditis elegans Hypothetical
           protein Y48B6A.6b protein.
          Length = 533

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 16/72 (22%), Positives = 29/72 (40%)
 Frame = +2

Query: 275 IPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 454
           +P     R+  V+  +  ++  +R KE+E      +   + + + R P PP    I    
Sbjct: 207 LPPTPPARITSVRSDESIEEEERRRKESEETASFEELEAEIMRISRSPVPPPVLSIPPPP 266

Query: 455 EKPVLLAPIPYE 490
              + L  IP E
Sbjct: 267 PPNIPLPTIPQE 278


>AL110490-6|CAB54442.2|  687|Caenorhabditis elegans Hypothetical
           protein Y48B6A.6a protein.
          Length = 687

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 16/72 (22%), Positives = 29/72 (40%)
 Frame = +2

Query: 275 IPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 454
           +P     R+  V+  +  ++  +R KE+E      +   + + + R P PP    I    
Sbjct: 207 LPPTPPARITSVRSDESIEEEERRRKESEETASFEELEAEIMRISRSPVPPPVLSIPPPP 266

Query: 455 EKPVLLAPIPYE 490
              + L  IP E
Sbjct: 267 PPNIPLPTIPQE 278


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,105,564
Number of Sequences: 27780
Number of extensions: 249983
Number of successful extensions: 938
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 877
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 937
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1049512662
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -