SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z71180-3|CAA94892.2|  763|Caenorhabditis elegans Hypothetical pr...    29   1.8  
AL021474-7|CAA16311.2|  763|Caenorhabditis elegans Hypothetical ...    29   1.8  
AF100656-2|AAF99970.1|  196|Caenorhabditis elegans Hypothetical ...    29   1.8  
Z68132-2|CAA92220.2|  762|Caenorhabditis elegans Hypothetical pr...    29   2.3  
Z83223-4|CAB05716.2|  534|Caenorhabditis elegans Hypothetical pr...    28   4.1  
U23147-7|AAC46691.1|  596|Caenorhabditis elegans Rapsyn protein ...    28   4.1  
U61948-4|AAB03146.1|  316|Caenorhabditis elegans Hypothetical pr...    28   5.4  
Z70306-3|CAA94325.1|  318|Caenorhabditis elegans Hypothetical pr...    27   7.2  
Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical pr...    27   7.2  
Z35639-8|CAI46560.1|  634|Caenorhabditis elegans Hypothetical pr...    27   7.2  
Z35639-7|CAA84697.3|  959|Caenorhabditis elegans Hypothetical pr...    27   7.2  
AY571963-1|AAS78587.1|  959|Caenorhabditis elegans ATX-2 protein.      27   7.2  
AF003388-4|AAB54269.1| 1150|Caenorhabditis elegans Hypothetical ...    27   7.2  
Z83107-6|CAD92391.1|  877|Caenorhabditis elegans Hypothetical pr...    27   9.5  
Z83107-4|CAB05498.1|  878|Caenorhabditis elegans Hypothetical pr...    27   9.5  
Z79596-2|CAC42251.1|  838|Caenorhabditis elegans Hypothetical pr...    27   9.5  
Z79596-1|CAB01857.1|  830|Caenorhabditis elegans Hypothetical pr...    27   9.5  
U00054-1|AAA50716.1|   91|Caenorhabditis elegans Hypothetical pr...    27   9.5  
L29031-1|AAB72228.2|  830|Caenorhabditis elegans dynamin protein.      27   9.5  
AL132952-8|CAB61142.2|  186|Caenorhabditis elegans Hypothetical ...    27   9.5  
AF167982-1|AAD50438.1|  838|Caenorhabditis elegans dynamin protein.    27   9.5  
AF038623-8|AAB94160.2|  631|Caenorhabditis elegans Hypothetical ...    27   9.5  

>Z71180-3|CAA94892.2|  763|Caenorhabditis elegans Hypothetical
           protein F22E12.1 protein.
          Length = 763

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +3

Query: 288 ENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQ 449
           E    +RP V +  P PP  Q   + N  +H +   +V+  K+ ++  E ALR+
Sbjct: 373 EQARYQRPPVQMPPPPPPPQQNSPSVNENYHPE---LVNQFKSHLDEHEKALRR 423


>AL021474-7|CAA16311.2|  763|Caenorhabditis elegans Hypothetical
           protein F22E12.1 protein.
          Length = 763

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +3

Query: 288 ENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQ 449
           E    +RP V +  P PP  Q   + N  +H +   +V+  K+ ++  E ALR+
Sbjct: 373 EQARYQRPPVQMPPPPPPPQQNSPSVNENYHPE---LVNQFKSHLDEHEKALRR 423


>AF100656-2|AAF99970.1|  196|Caenorhabditis elegans Hypothetical
           protein F49F1.3 protein.
          Length = 196

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 2/79 (2%)
 Frame = -2

Query: 242 ISSTITLTGMSMTSFLFARRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGMAG 63
           +S   TL  +S ++  F   LL + + +LA ++       L   F G+    G++ G+AG
Sbjct: 25  LSRKATLYPLSYSTKNFLTLLL-VFVALLAVTVVEAGDPDLGGIFSGIGGMLGSIGGLAG 83

Query: 62  CACG--EHEYS*QQGRV*F 12
              G  +HE   ++GR+ F
Sbjct: 84  AGGGKKKHEARIEEGRIYF 102


>Z68132-2|CAA92220.2|  762|Caenorhabditis elegans Hypothetical
           protein F09C8.2 protein.
          Length = 762

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +1

Query: 61  QPAIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIK-DIDNSLRANKKEVID 213
           +P+ P KVP A  K   +     S+QEL  ++  +  D+ ++L +NKKE+ID
Sbjct: 489 KPSQPAKVPAAPIKAPRL-----SDQELESESQKLALDVISNLFSNKKEIID 535



 Score = 28.3 bits (60), Expect = 4.1
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +3

Query: 288 ENEEIKRPLVDLRNPGPPQHQEHETQNPE 374
           EN+  +   V+ + P P QHQ+ + Q PE
Sbjct: 404 ENQRYEGNFVEYQPPPPQQHQQQQPQAPE 432


>Z83223-4|CAB05716.2|  534|Caenorhabditis elegans Hypothetical
           protein E01G4.4 protein.
          Length = 534

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +3

Query: 333 GPPQHQEHETQNPEHHEDAEKIVSSVKN 416
           GPP HQ+H  Q  +H+  A    SS  N
Sbjct: 133 GPPVHQQHYQQQQQHYGAATSAPSSSYN 160


>U23147-7|AAC46691.1|  596|Caenorhabditis elegans Rapsyn protein 1
           protein.
          Length = 596

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 22  RPCC*LYSCSPHAQPAIPDKVPEAEDKPL 108
           +PCC   +  P +  A+P  +P AED PL
Sbjct: 557 KPCCSQAALPPSSIVALPPAMPLAEDGPL 585


>U61948-4|AAB03146.1|  316|Caenorhabditis elegans Hypothetical
           protein C46A5.6 protein.
          Length = 316

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +1

Query: 442 FVK-ASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSDTKV 567
           F+K A R+  TVLE  T  P+K     QL+   RKF+R+DT+V
Sbjct: 66  FLKVAKRRSSTVLETAT--PAKTPKI-QLSERRRKFQRNDTEV 105


>Z70306-3|CAA94325.1|  318|Caenorhabditis elegans Hypothetical
           protein C06G8.4 protein.
          Length = 318

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -2

Query: 245 LISSTITLTGMSMTSFLFARRLLSMSLMVLAWSMSSCSL 129
           LI+ T+T  G  +T FL  +R++     +L  S   CSL
Sbjct: 45  LINITLTNVGACVTGFLLDQRIIQSGKSMLYVSYGYCSL 83


>Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical protein
            T28C6.9 protein.
          Length = 1861

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/49 (24%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 61   QPAIPDKVPEAEDKPLNVVDNLSS-EQELIDQANTIKDIDNSLRANKKE 204
            +  + +++   ED+ L + + L   E+EL+D+ N  K++D  +    +E
Sbjct: 1248 EKVLNNRILSLEDQNLELEERLQEMEEELLDEKNKKKEVDAKVEQKSEE 1296


>Z35639-8|CAI46560.1|  634|Caenorhabditis elegans Hypothetical
           protein D2045.1b protein.
          Length = 634

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +3

Query: 330 PGPPQHQEHETQNPEHH 380
           P PPQ Q  + Q+P HH
Sbjct: 469 PPPPQQQHQQQQHPPHH 485


>Z35639-7|CAA84697.3|  959|Caenorhabditis elegans Hypothetical
           protein D2045.1a protein.
          Length = 959

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +3

Query: 330 PGPPQHQEHETQNPEHH 380
           P PPQ Q  + Q+P HH
Sbjct: 794 PPPPQQQHQQQQHPPHH 810


>AY571963-1|AAS78587.1|  959|Caenorhabditis elegans ATX-2 protein.
          Length = 959

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +3

Query: 330 PGPPQHQEHETQNPEHH 380
           P PPQ Q  + Q+P HH
Sbjct: 794 PPPPQQQHQQQQHPPHH 810


>AF003388-4|AAB54269.1| 1150|Caenorhabditis elegans Hypothetical
           protein R10F2.6 protein.
          Length = 1150

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = +3

Query: 342 QHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQIKSSRP 521
           +HQ+HE Q  +  E+AEK +  +K D+   EI  +     V + + K   R E  +    
Sbjct: 567 EHQKHEDQT-DKSEEAEKKM-KIKADLAAKEIWDKNMEHNVDEILMKRVNRVEMCRIQMA 624

Query: 522 ACNISKKI 545
             N+ +K+
Sbjct: 625 LQNLDQKL 632


>Z83107-6|CAD92391.1|  877|Caenorhabditis elegans Hypothetical
           protein F32A7.5c protein.
          Length = 877

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/46 (26%), Positives = 21/46 (45%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSS 407
           NV    E ++I  P+   + P P +  + +   P H E +  +V S
Sbjct: 474 NVSGGSEEDKIPEPVDAFKKPDPVELDDFDPLKPSHPEPSAPVVPS 519


>Z83107-4|CAB05498.1|  878|Caenorhabditis elegans Hypothetical
           protein F32A7.5a protein.
          Length = 878

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/46 (26%), Positives = 21/46 (45%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSS 407
           NV    E ++I  P+   + P P +  + +   P H E +  +V S
Sbjct: 474 NVSGGSEEDKIPEPVDAFKKPDPVELDDFDPLKPSHPEPSAPVVPS 519


>Z79596-2|CAC42251.1|  838|Caenorhabditis elegans Hypothetical
           protein C02C6.1b protein.
          Length = 838

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 73  PDKVPEAEDKPLNVVDNLSSEQELIDQANTIKD-IDNSLRANKKEVIDIPVKVIVEEI 243
           P+K    ED+    +++ S + +L  Q  TI++ +D+ +R   K + D+  K ++  I
Sbjct: 626 PEKQKAQEDESQQEMEDTSIDPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLI 683


>Z79596-1|CAB01857.1|  830|Caenorhabditis elegans Hypothetical
           protein C02C6.1a protein.
          Length = 830

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 73  PDKVPEAEDKPLNVVDNLSSEQELIDQANTIKD-IDNSLRANKKEVIDIPVKVIVEEI 243
           P+K    ED+    +++ S + +L  Q  TI++ +D+ +R   K + D+  K ++  I
Sbjct: 626 PEKQKAQEDESQQEMEDTSIDPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLI 683


>U00054-1|AAA50716.1|   91|Caenorhabditis elegans Hypothetical
           protein K07E12.2 protein.
          Length = 91

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +3

Query: 456 QEVSDGIGKWYARTEQIKSSRPACNISKKI 545
           +++S+G GKW+   E  KS++     SKKI
Sbjct: 18  KKLSEGRGKWFKGVETRKSNKEKKKNSKKI 47


>L29031-1|AAB72228.2|  830|Caenorhabditis elegans dynamin protein.
          Length = 830

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 73  PDKVPEAEDKPLNVVDNLSSEQELIDQANTIKD-IDNSLRANKKEVIDIPVKVIVEEI 243
           P+K    ED+    +++ S + +L  Q  TI++ +D+ +R   K + D+  K ++  I
Sbjct: 626 PEKQKAQEDESQQEMEDTSIDPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLI 683


>AL132952-8|CAB61142.2|  186|Caenorhabditis elegans Hypothetical
           protein Y51H4A.8 protein.
          Length = 186

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 27  LLLTIFVLAARAACHPGQGPRGRR*TF 107
           LLL  F ++   AC PG G  G + TF
Sbjct: 5   LLLLCFFISTAGACAPGTGTLGSKGTF 31


>AF167982-1|AAD50438.1|  838|Caenorhabditis elegans dynamin protein.
          Length = 838

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 73  PDKVPEAEDKPLNVVDNLSSEQELIDQANTIKD-IDNSLRANKKEVIDIPVKVIVEEI 243
           P+K    ED+    +++ S + +L  Q  TI++ +D+ +R   K + D+  K ++  I
Sbjct: 626 PEKQKAQEDESQQEMEDTSIDPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLI 683


>AF038623-8|AAB94160.2|  631|Caenorhabditis elegans Hypothetical
           protein T08B6.4 protein.
          Length = 631

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 17/84 (20%), Positives = 35/84 (41%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQ 449
           N+   D N+++K   V+  NP  P+    + + P + +    I+ + +          R 
Sbjct: 160 NMTGKDSNKDVKDVDVEAANPENPETNICKDKRPGYSQKTGAILFANEGKCLEMHKLGRD 219

Query: 450 GFQEVSDGIGKWYARTEQIKSSRP 521
            + E    + +W    E +K+ RP
Sbjct: 220 KYSEEYIQVPRWLQPGESVKNIRP 243


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,097,223
Number of Sequences: 27780
Number of extensions: 211885
Number of successful extensions: 1135
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 996
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1135
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1184216096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -