SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical pr...   181   4e-46
Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical pr...   181   4e-46
Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical pr...   123   1e-28
M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein ( C.ele...   123   1e-28
Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical pr...   107   8e-24
U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock prot...   107   8e-24
M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C. el...   107   8e-24
AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock pr...   103   1e-22
X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.        95   5e-20
U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock prot...    95   5e-20
Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical p...    81   8e-16
Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical pr...    81   8e-16
Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical pr...    64   1e-10
L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical pr...    54   1e-07
U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical pr...    47   2e-05
Z67884-4|CAH60753.1|  905|Caenorhabditis elegans Hypothetical pr...    44   1e-04
Z67884-3|CAA91809.2|  921|Caenorhabditis elegans Hypothetical pr...    44   1e-04
U41748-3|AAA83336.1|  452|Caenorhabditis elegans Dumpy : shorter...    31   1.2  
Z70284-14|CAA94285.4|  422|Caenorhabditis elegans Hypothetical p...    30   1.5  
AF022979-6|ABD94088.1|   94|Caenorhabditis elegans Hypothetical ...    30   1.5  
U14635-13|AAC46654.2|  322|Caenorhabditis elegans Hypothetical p...    29   4.7  
AF039044-13|AAG24128.2|  435|Caenorhabditis elegans Hypothetical...    29   4.7  
AL117204-6|CAB55149.2|  833|Caenorhabditis elegans Hypothetical ...    28   6.2  
AC006805-1|AAK68515.1|  129|Caenorhabditis elegans Hypothetical ...    24   6.2  
U40959-4|AAA81768.1|  112|Caenorhabditis elegans Hypothetical pr...    28   8.1  

>Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.5 protein.
          Length = 645

 Score =  181 bits (441), Expect = 4e-46
 Identities = 108/232 (46%), Positives = 138/232 (59%), Gaps = 6/232 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 252 MTP-TTQYSMPNVSS---DVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPR 419
             P  T +    +     D S+    CK     G+   Q   +   +  + G ++   P 
Sbjct: 61  RNPENTVFDAKRLIGRRFDESTVQSDCKHW-PFGVKGKQ--GKPVIEVEVKGEKRQFNPE 117

Query: 420 GSQFHGAYENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
                   + +    +       +      AYFNDSQRQATKDA TI+GLN +RIINEPT
Sbjct: 118 EISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPT 177

Query: 600 AAAIAYGLDKKGTGERNVLIFDLGGGT--STCPSLPSRRYLRGEIHRGDTHL 749
           AAA+AYGLDK    E+NVLIFDLGGGT   +  S+        +   GDTHL
Sbjct: 178 AAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHL 229



 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 36/56 (64%), Positives = 42/56 (75%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V    GKP I+V  KGE + F PEE+S+MVL KMKETAE YLG TV++AVITVP
Sbjct: 92  FGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVP 147



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 24/57 (42%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+++TVQ+D KHWPF +   +        ++ + + F+P +
Sbjct: 62  NPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEE 118


>Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.4 protein.
          Length = 645

 Score =  181 bits (441), Expect = 4e-46
 Identities = 108/232 (46%), Positives = 138/232 (59%), Gaps = 6/232 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 252 MTP-TTQYSMPNVSS---DVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPR 419
             P  T +    +     D S+    CK     G+   Q   +   +  + G ++   P 
Sbjct: 61  RNPENTVFDAKRLIGRRFDESTVQSDCKHW-PFGVKGKQ--GKPVIEVEVKGEKRQFNPE 117

Query: 420 GSQFHGAYENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
                   + +    +       +      AYFNDSQRQATKDA TI+GLN +RIINEPT
Sbjct: 118 EISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPT 177

Query: 600 AAAIAYGLDKKGTGERNVLIFDLGGGT--STCPSLPSRRYLRGEIHRGDTHL 749
           AAA+AYGLDK    E+NVLIFDLGGGT   +  S+        +   GDTHL
Sbjct: 178 AAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHL 229



 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 36/56 (64%), Positives = 42/56 (75%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V    GKP I+V  KGE + F PEE+S+MVL KMKETAE YLG TV++AVITVP
Sbjct: 92  FGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVP 147



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 24/57 (42%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+++TVQ+D KHWPF +   +        ++ + + F+P +
Sbjct: 62  NPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEE 118


>Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical
           protein F26D10.3 protein.
          Length = 640

 Score =  123 bits (297), Expect = 1e-28
 Identities = 58/63 (92%), Positives = 59/63 (93%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K  AVGIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63



 Score =  114 bits (275), Expect = 5e-26
 Identities = 60/81 (74%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKG GERNVLIFDLGGGT   
Sbjct: 149 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDV 208

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 209 SILTIEDGIFEVKSTAGDTHL 229



 Score = 84.6 bits (200), Expect = 7e-17
 Identities = 39/57 (68%), Positives = 50/57 (87%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+S +G KPK++V YKGE+K F PEE+SSMVL KMKETAEA+LG TV++AV+TVP
Sbjct: 92  FKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVP 148



 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFE-LSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NT+FDAKRLIGRKF+D  VQ+DMKHWPF+ +S   A  + +   + + K F+P +
Sbjct: 62  NPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEE 119


>M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein (
           C.elegans heat shockprotein 70A gene, complete cds. ).
          Length = 640

 Score =  123 bits (297), Expect = 1e-28
 Identities = 58/63 (92%), Positives = 59/63 (93%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K  AVGIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63



 Score =  113 bits (271), Expect = 2e-25
 Identities = 59/80 (73%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTCP 692
           YFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKG GERNVLIFDLGGGT    
Sbjct: 150 YFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVS 209

Query: 693 SLP-SRRYLRGEIHRGDTHL 749
            L         +   GDTHL
Sbjct: 210 ILTIEDGIFEVKSTAGDTHL 229



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 37/57 (64%), Positives = 49/57 (85%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+S +G KPK++V YKGE+K F PEE+SSMVL KMK+TAEA+L  TV++AV+TVP
Sbjct: 92  FKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKKTAEAFLEPTVKDAVVTVP 148



 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFE-LSVMEANLRSR*HIRVKTKPFSPRK 424
           +P+NT+FDAKRLIGRKF+D  VQ+DMKHWPF+ +S   A  + +   + + K F+P +
Sbjct: 62  NPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEE 119


>Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical
           protein C12C8.1 protein.
          Length = 643

 Score =  107 bits (257), Expect = 8e-24
 Identities = 46/63 (73%), Positives = 56/63 (88%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSTCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 252 MTP 260
             P
Sbjct: 61  RNP 63



 Score =  103 bits (248), Expect = 1e-22
 Identities = 53/82 (64%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT--S 683
           AYFNDSQRQATKDA TI+GLN +RIINEPTAAA+AYGLDK  T E+N+LIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGITDEKNILIFDLGGGTFDV 207

Query: 684 TCPSLPSRRYLRGEIHRGDTHL 749
           +  S+        +   GDTHL
Sbjct: 208 SILSIAEGSIFEVKSTAGDTHL 229



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 33/56 (58%), Positives = 41/56 (73%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V    GKP ++V  KGE + F  EE+S+MVL KMKETAEA LG +V++AVITVP
Sbjct: 92  FTVKGKQGKPVVEVEVKGEKREFNAEEISAMVLQKMKETAEAVLGHSVRDAVITVP 147



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 22/31 (70%), Positives = 29/31 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPF 346
           +P NT+FDAKRLIGR+F++ TVQ+D+KHWPF
Sbjct: 62  NPENTVFDAKRLIGRRFDEETVQSDIKHWPF 92


>U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock protein
           protein 3 protein.
          Length = 661

 Score =  107 bits (257), Expect = 8e-24
 Identities = 56/81 (69%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDKK  GERN+L+FDLGGGT   
Sbjct: 179 AYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK-DGERNILVFDLGGGTFDV 237

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 238 SMLTIDNGVFEVLATNGDTHL 258



 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 43/59 (72%), Positives = 52/59 (88%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAF+    +RLIGDAAKNQ+ + P
Sbjct: 36  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINP 94



 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 32/56 (57%), Positives = 42/56 (75%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+    KP ++V    ++K F PEEVS+MVL KMKE AE+YLGK V+NAV+TVP
Sbjct: 123 FKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVP 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 24/33 (72%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTIFDAKRLIGR + D TVQAD+KHWPF++
Sbjct: 93  NPENTIFDAKRLIGRDYNDKTVQADIKHWPFKV 125


>M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C.
           elegans BiP (hsp3)gene, complete cds. ).
          Length = 661

 Score =  107 bits (257), Expect = 8e-24
 Identities = 56/81 (69%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDKK  GERN+L+FDLGGGT   
Sbjct: 179 AYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK-DGERNILVFDLGGGTFDV 237

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 238 SMLTIDNGVFEVLATNGDTHL 258



 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 43/59 (72%), Positives = 52/59 (88%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAF+    +RLIGDAAKNQ+ + P
Sbjct: 36  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINP 94



 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 32/56 (57%), Positives = 42/56 (75%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+    KP ++V    ++K F PEEVS+MVL KMKE AE+YLGK V+NAV+TVP
Sbjct: 123 FKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVP 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 24/33 (72%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTIFDAKRLIGR + D TVQAD+KHWPF++
Sbjct: 93  NPENTIFDAKRLIGRDYNDKTVQADIKHWPFKV 125


>AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock
           protein protein 4 protein.
          Length = 657

 Score =  103 bits (248), Expect = 1e-22
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+Q+QATKDAG+I+GLNV+RIINEPTAAAIAYGLDKK  GERN+L+FDLGGGT   
Sbjct: 176 AYFNDAQKQATKDAGSIAGLNVVRIINEPTAAAIAYGLDKK-DGERNILVFDLGGGTFDV 234

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 235 SLLTIDSGVFEVLATNGDTHL 255



 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAF+    ERLIGDAAKNQ+ + P
Sbjct: 33  IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSGDQGERLIGDAAKNQLTINP 91



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 32/56 (57%), Positives = 41/56 (73%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F++V    KP ++V    E K F PEEVS+MVLTKMK+ AE+YLG  V+NAV+TVP
Sbjct: 120 FKIVDKSNKPNVEVKVGSETKQFTPEEVSAMVLTKMKQIAESYLGHEVKNAVVTVP 175



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 26/57 (45%), Positives = 36/57 (63%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NTIFDAKRLIGR + + TVQ D+KHWPF++            +  +TK F+P +
Sbjct: 90  NPENTIFDAKRLIGRFYNEKTVQQDIKHWPFKIVDKSNKPNVEVKVGSETKQFTPEE 146


>X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.
          Length = 487

 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 44/57 (77%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLD K  G++ + ++DLGGGT
Sbjct: 173 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLD-KDAGDKIIAVYDLGGGT 228



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 245
           K   +GIDLGTT SCV + +    ++I N +G RTTPS VAFT D ERL+G  AK Q
Sbjct: 30  KGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQ 86



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/40 (55%), Positives = 29/40 (72%)
 Frame = +1

Query: 391 KGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + + K + P +V + VL KMKETAE+YLG TV N V+TVP
Sbjct: 133 EAQGKEYPPSQVGAFVLMKMKETAESYLGTTVNNPVVTVP 172



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 16/30 (53%), Positives = 23/30 (76%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           NT+F  KRLIGR++ED  VQ D+K  P+++
Sbjct: 93  NTLFATKRLIGRRYEDPEVQKDLKVVPYKI 122


>U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock protein
           protein 6 protein.
          Length = 657

 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 44/57 (77%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLD K  G++ + ++DLGGGT
Sbjct: 173 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLD-KDAGDKIIAVYDLGGGT 228



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 245
           K   +GIDLGTT SCV + +    ++I N +G RTTPS VAFT D ERL+G  AK Q
Sbjct: 30  KGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQ 86



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 23/40 (57%), Positives = 30/40 (75%)
 Frame = +1

Query: 391 KGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + + K + P +V + VL KMKETAE+YLG TV NAV+TVP
Sbjct: 133 EAQGKVYSPSQVGAFVLMKMKETAESYLGTTVNNAVVTVP 172



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 16/30 (53%), Positives = 23/30 (76%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           NT+F  KRLIGR++ED  VQ D+K  P+++
Sbjct: 93  NTLFATKRLIGRRYEDPEVQKDLKVVPYKI 122


>Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 42/81 (51%), Positives = 55/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DLGGGT   
Sbjct: 145 AYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDLGGGTFDV 204

Query: 690 PSL-PSRRYLRGEIHRGDTHL 749
            ++      +  +   GDTHL
Sbjct: 205 AAVNVDGPRITVKAKGGDTHL 225



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTPT 263
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +     
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVIGKATN 61

Query: 264 TQYSMPNV 287
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 15/30 (50%), Positives = 24/30 (80%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           N++FD KR+IGR+++D  +Q DM  WPF++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKV 90



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +1

Query: 358 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           D G P +++    +   F    VSS++L  +K  AE  LG  V++AVITVP
Sbjct: 94  DNGIPYLEIHKNEKPLKFSAVTVSSLILRCLKYNAERKLGLEVKSAVITVP 144


>Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 42/81 (51%), Positives = 55/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DLGGGT   
Sbjct: 145 AYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDLGGGTFDV 204

Query: 690 PSL-PSRRYLRGEIHRGDTHL 749
            ++      +  +   GDTHL
Sbjct: 205 AAVNVDGPRITVKAKGGDTHL 225



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTPT 263
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +     
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVIGKATN 61

Query: 264 TQYSMPNV 287
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 15/30 (50%), Positives = 24/30 (80%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           N++FD KR+IGR+++D  +Q DM  WPF++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKV 90



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +1

Query: 358 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           D G P +++    +   F    VSS++L  +K  AE  LG  V++AVITVP
Sbjct: 94  DNGIPYLEIHKNEKPLKFSAVTVSSLILRCLKYNAERKLGLEVKSAVITVP 144


>Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical
           protein F54C9.2 protein.
          Length = 450

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 32/57 (56%), Positives = 40/57 (70%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A FN+ QR  T  A  I+ + V R+I+EPTAAA+AYGL KK  G  NV++ DLGGGT
Sbjct: 183 AEFNEKQRNFTAKAAEIAEMEVRRVISEPTAAALAYGLHKK-QGVENVVVVDLGGGT 238



 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 5/71 (7%)
 Frame = +3

Query: 63  KYKMAKAPA--VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER-LIG 227
           KY +   P    GIDLGTTYS +G++    G+  I+ +D G ++ PS VAF      LIG
Sbjct: 25  KYGLPPPPPKIAGIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIG 84

Query: 228 DAAKNQVAMTP 260
             A  Q    P
Sbjct: 85  TRATEQQEHNP 95



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 2/37 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFE--DATVQADMKHWPFELSV 358
           +P  TI+DAKR IGR FE  +    +D K +PF++++
Sbjct: 94  NPKRTIYDAKRFIGRNFEKNNKDFLSDQKRYPFKINL 130



 Score = 35.5 bits (78), Expect = 0.041
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F++  D  GK   ++      K  +PEE+ S+++  +K  A  +LG T+   VI+ P
Sbjct: 126 FKINLDSEGKAFFEIPLDSGTKNVYPEEIGSLIIGYLKSAAAKHLGVTLGQVVISCP 182


>L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical
           protein C30C11.4 protein.
          Length = 776

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RN 650
           ++C     +YF D QR+A   A   +GLN LRI+NE TA A+AYG+ K+   E     RN
Sbjct: 140 SDCVLAVPSYFTDVQRRAVLSAIQYAGLNSLRIVNETTAIALAYGIYKQDLPEEDAKSRN 199

Query: 651 VLIFDLGGGTSTCPSLPSRRYLRGEIHRGDT 743
           V+  D+ G +ST  SL +  + RG++   +T
Sbjct: 200 VVFLDI-GHSSTQASLVA--FNRGKLQMVNT 227



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           +G D+G     +GV + G +E+I ND     TP+ V+F   +R +G AA+  V
Sbjct: 4   LGFDIGNLNCYIGVARQGGIEVITNDYSLHATPACVSFGPKDRSMGVAARQAV 56



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = +1

Query: 376 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG--KTVQNAVITVP 510
           ++V+Y GE  TF PE+V + +LTK++   E+ L   K V + V+ VP
Sbjct: 101 VQVSYLGEPHTFTPEQVLAALLTKLRTIVESQLSDVKKVSDCVLAVP 147


>U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical
           protein T24H7.2 protein.
          Length = 925

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/61 (36%), Positives = 42/61 (68%), Gaps = 3/61 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLGGGTS 683
           YF  ++R A + A  ++GL VL++IN+ TAAA+++G+  +K  GE+   ++++D+G   +
Sbjct: 171 YFTPAERLAVERAAQMAGLTVLQLINDGTAAALSHGIFRRKEIGEKPQRLMVYDMGAAKT 230

Query: 684 T 686
           T
Sbjct: 231 T 231



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           A+ IDLGT +  +G+ + G  ++I  N +  R TP+ V   D  R   DAA
Sbjct: 26  AMTIDLGTQFLKIGIVKPGIPMDIALNTESRRKTPNVVMIQDGHRTFADAA 76


>Z67884-4|CAH60753.1|  905|Caenorhabditis elegans Hypothetical
           protein T14G8.3b protein.
          Length = 905

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 42/61 (68%), Gaps = 3/61 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLGGGTS 683
           + N ++R+A   A  I+GLN+L+++N+ +AAA+ YG+  +K   E+  ++LI+D+G   +
Sbjct: 155 FLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKT 214

Query: 684 T 686
           T
Sbjct: 215 T 215



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 15/43 (34%), Positives = 27/43 (62%)
 Frame = +1

Query: 382 VAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V +  +++ +  E + +M+L   K+  EAY  +TV++ VITVP
Sbjct: 111 VVFPYKEEKYNVETLLAMILWNAKKVTEAYADQTVKDVVITVP 153


>Z67884-3|CAA91809.2|  921|Caenorhabditis elegans Hypothetical
           protein T14G8.3a protein.
          Length = 921

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 42/61 (68%), Gaps = 3/61 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLGGGTS 683
           + N ++R+A   A  I+GLN+L+++N+ +AAA+ YG+  +K   E+  ++LI+D+G   +
Sbjct: 171 FLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKT 230

Query: 684 T 686
           T
Sbjct: 231 T 231



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 15/43 (34%), Positives = 27/43 (62%)
 Frame = +1

Query: 382 VAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V +  +++ +  E + +M+L   K+  EAY  +TV++ VITVP
Sbjct: 127 VVFPYKEEKYNVETLLAMILWNAKKVTEAYADQTVKDVVITVP 169


>U41748-3|AAA83336.1|  452|Caenorhabditis elegans Dumpy : shorter
           than wild-typeprotein 8 protein.
          Length = 452

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +2

Query: 203 HRHRASHRR--CRQEPGGDDPNNTIFDAKRLIGR-KFEDATVQADM 331
           H+HR SHR     Q+  GD+ NN + DA R +   ++ D +  + M
Sbjct: 347 HQHRKSHRLRPSHQQQYGDEQNNAVADAGRSVNAPEYGDGSAPSHM 392


>Z70284-14|CAA94285.4|  422|Caenorhabditis elegans Hypothetical
           protein K07F5.14 protein.
          Length = 422

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +2

Query: 233 RQEPGGDDPNNTIFDAKRLIGRKFEDATVQAD 328
           ++   GDDP+   F    +IGRK++D  V+ D
Sbjct: 278 KERKDGDDPSTGGFSFLSMIGRKYDDEAVEDD 309


>AF022979-6|ABD94088.1|   94|Caenorhabditis elegans Hypothetical
           protein T02B11.8 protein.
          Length = 94

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/32 (40%), Positives = 16/32 (50%)
 Frame = -2

Query: 266 CCWGHRHLVLGGISDETLGVCERNIRRSGPVA 171
           CC G  H    G S  T+G C+R    S PV+
Sbjct: 58  CCPGTNHCCPPGFSCTTIGTCKRTTTLSNPVS 89


>U14635-13|AAC46654.2|  322|Caenorhabditis elegans Hypothetical
           protein C27H5.6 protein.
          Length = 322

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 3/81 (3%)
 Frame = +3

Query: 501 HGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG--- 671
           HGS + N ++++       +SG+NVL +++ P    +A   D+  + E +VL+  +    
Sbjct: 208 HGSKFLNHTEKRKQMAILILSGINVL-MVSVPNFVLVA---DQWHSDEFDVLLVGVAYLL 263

Query: 672 GGTSTCPSLPSRRYLRGEIHR 734
            G  +C +LP   + R E  R
Sbjct: 264 YGFQSCFNLPIFYFFRLEFRR 284


>AF039044-13|AAG24128.2|  435|Caenorhabditis elegans Hypothetical
           protein F48G7.12 protein.
          Length = 435

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 12/54 (22%), Positives = 29/54 (53%)
 Frame = +3

Query: 165 DQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKP 326
           D G+    ++V   D +++IG+    +  +   T+Y++    +  SS+++L +P
Sbjct: 12  DIGDGLFQTHVQLEDVQKVIGEQMNTKARLGENTKYTVIGDGNGFSSRVILVEP 65


>AL117204-6|CAB55149.2|  833|Caenorhabditis elegans Hypothetical
           protein Y116A8C.13 protein.
          Length = 833

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = +1

Query: 142 GRWRSSPTTR-ATGPLRLMLRSQTPSVSSEMPPRT 243
           G W      R ATGP +  + +Q P + S MPP T
Sbjct: 84  GSWSVEIQERIATGPPQKPISAQKPEIQSPMPPMT 118


>AC006805-1|AAK68515.1|  129|Caenorhabditis elegans Hypothetical
           protein Y54B9A.1 protein.
          Length = 129

 Score = 23.8 bits (49), Expect(2) = 6.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +3

Query: 717 RGEIHRGDTH 746
           RGE HRG+TH
Sbjct: 61  RGETHRGETH 70



 Score = 23.0 bits (47), Expect(2) = 6.2
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 708 RYLRGEIHRGDT 743
           R LRGE HRG+T
Sbjct: 28  RDLRGETHRGET 39


>U40959-4|AAA81768.1|  112|Caenorhabditis elegans Hypothetical
           protein B0310.4 protein.
          Length = 112

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = +3

Query: 708 RYLRGEIHRGDTH 746
           RY RGE HRG+TH
Sbjct: 4   RYYRGESHRGETH 16


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,163,974
Number of Sequences: 27780
Number of extensions: 438986
Number of successful extensions: 1528
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 1224
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1510
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1777507862
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -