SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical pr...   167   7e-42
M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein ( C.ele...   165   2e-41
U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock prot...   148   4e-36
M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C. el...   148   4e-36
AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock pr...   145   3e-35
Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical pr...   145   3e-35
Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical pr...   143   1e-34
Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical pr...   143   1e-34
X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.       135   3e-32
U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock prot...   135   3e-32
Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical p...   106   1e-23
Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical pr...   106   1e-23
Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical pr...    88   6e-18
L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical pr...    66   2e-11
U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical pr...    50   2e-06
Z67884-4|CAH60753.1|  905|Caenorhabditis elegans Hypothetical pr...    47   1e-05
Z67884-3|CAA91809.2|  921|Caenorhabditis elegans Hypothetical pr...    47   1e-05
AF022979-6|ABD94088.1|   94|Caenorhabditis elegans Hypothetical ...    31   0.67 
Z81136-5|CAB03460.2|  733|Caenorhabditis elegans Hypothetical pr...    28   6.3  
AL117204-6|CAB55149.2|  833|Caenorhabditis elegans Hypothetical ...    28   6.3  
AF078792-4|AAN84813.1|  261|Caenorhabditis elegans Hypothetical ...    28   6.3  
AF078792-3|AAC26945.2|  635|Caenorhabditis elegans Hypothetical ...    28   6.3  
Z92864-3|CAB07434.1|   48|Caenorhabditis elegans Hypothetical pr...    28   8.3  

>Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical
           protein F26D10.3 protein.
          Length = 640

 Score =  167 bits (406), Expect = 7e-42
 Identities = 80/84 (95%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKG GERNVLIFDLGGGTF
Sbjct: 147 VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTF 206

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 207 DVSILTIEDGIFEVKSTAGDTHLG 230



 Score =  140 bits (338), Expect = 1e-33
 Identities = 62/88 (70%), Positives = 78/88 (88%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEV 430
           +NP+NT+FDAKRLIGRKF+D  VQ+DMKHWPF+V+S +G KPK++V YKGE+K F PEE+
Sbjct: 61  MNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEI 120

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KMKETAEA+LG TV++AV+T P
Sbjct: 121 SSMVLLKMKETAEAFLGTTVKDAVVTVP 148



 Score =  120 bits (288), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K  AVGIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  MNP 63


>M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein (
           C.elegans heat shockprotein 70A gene, complete cds. ).
          Length = 640

 Score =  165 bits (402), Expect = 2e-41
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP YFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKG GERNVLIFDLGGGTF
Sbjct: 147 VPTYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTF 206

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 207 DVSILTIEDGIFEVKSTAGDTHLG 230



 Score =  135 bits (326), Expect = 4e-32
 Identities = 60/88 (68%), Positives = 77/88 (87%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEV 430
           +NP+NT+FDAKRLIGRKF+D  VQ+DMKHWPF+V+S +G KPK++V YKGE+K F PEE+
Sbjct: 61  MNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEI 120

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KMK+TAEA+L  TV++AV+T P
Sbjct: 121 SSMVLLKMKKTAEAFLEPTVKDAVVTVP 148



 Score =  120 bits (288), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K  AVGIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  MNP 63


>U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock protein
           protein 3 protein.
          Length = 661

 Score =  148 bits (359), Expect = 4e-36
 Identities = 69/84 (82%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDKK  GERN+L+FDLGGGTF
Sbjct: 177 VPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK-DGERNILVFDLGGGTF 235

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 236 DVSMLTIDNGVFEVLATNGDTHLG 259



 Score =  125 bits (301), Expect = 4e-29
 Identities = 55/87 (63%), Positives = 68/87 (78%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGR + D TVQAD+KHWPF+V+    KP ++V    ++K F PEEVS
Sbjct: 92  INPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVS 151

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVL KMKE AE+YLGK V+NAV+T P
Sbjct: 152 AMVLVKMKEIAESYLGKEVKNAVVTVP 178



 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 43/59 (72%), Positives = 51/59 (86%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAF+    +RLIGDAAKNQ+   P
Sbjct: 36  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINP 94


>M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C.
           elegans BiP (hsp3)gene, complete cds. ).
          Length = 661

 Score =  148 bits (359), Expect = 4e-36
 Identities = 69/84 (82%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDKK  GERN+L+FDLGGGTF
Sbjct: 177 VPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK-DGERNILVFDLGGGTF 235

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 236 DVSMLTIDNGVFEVLATNGDTHLG 259



 Score =  125 bits (301), Expect = 4e-29
 Identities = 55/87 (63%), Positives = 68/87 (78%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGR + D TVQAD+KHWPF+V+    KP ++V    ++K F PEEVS
Sbjct: 92  INPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVS 151

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVL KMKE AE+YLGK V+NAV+T P
Sbjct: 152 AMVLVKMKEIAESYLGKEVKNAVVTVP 178



 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 43/59 (72%), Positives = 51/59 (86%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAF+    +RLIGDAAKNQ+   P
Sbjct: 36  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINP 94


>AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock
           protein protein 4 protein.
          Length = 657

 Score =  145 bits (352), Expect = 3e-35
 Identities = 67/84 (79%), Positives = 78/84 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+Q+QATKDAG+I+GLNV+RIINEPTAAAIAYGLDKK  GERN+L+FDLGGGTF
Sbjct: 174 VPAYFNDAQKQATKDAGSIAGLNVVRIINEPTAAAIAYGLDKK-DGERNILVFDLGGGTF 232

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI+ G+FEV +T GDTH G
Sbjct: 233 DVSLLTIDSGVFEVLATNGDTHLG 256



 Score =  119 bits (287), Expect = 2e-27
 Identities = 53/87 (60%), Positives = 66/87 (75%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGR + + TVQ D+KHWPF++V    KP ++V    E K F PEEVS
Sbjct: 89  INPENTIFDAKRLIGRFYNEKTVQQDIKHWPFKIVDKSNKPNVEVKVGSETKQFTPEEVS 148

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMK+ AE+YLG  V+NAV+T P
Sbjct: 149 AMVLTKMKQIAESYLGHEVKNAVVTVP 175



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAF+    ERLIGDAAKNQ+   P
Sbjct: 33  IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSGDQGERLIGDAAKNQLTINP 91


>Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical
           protein C12C8.1 protein.
          Length = 643

 Score =  145 bits (351), Expect = 3e-35
 Identities = 70/85 (82%), Positives = 77/85 (90%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDA TI+GLN +RIINEPTAAA+AYGLDK  T E+N+LIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGITDEKNILIFDLGGGTF 205

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSIL+I +G IFEVKSTAGDTH G
Sbjct: 206 DVSILSIAEGSIFEVKSTAGDTHLG 230



 Score =  119 bits (286), Expect = 3e-27
 Identities = 54/86 (62%), Positives = 68/86 (79%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR+F++ TVQ+D+KHWPF V    GKP ++V  KGE + F  EE+S+
Sbjct: 62  NPENTVFDAKRLIGRRFDEETVQSDIKHWPFTVKGKQGKPVVEVEVKGEKREFNAEEISA 121

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAEA LG +V++AVIT P
Sbjct: 122 MVLQKMKETAEAVLGHSVRDAVITVP 147



 Score =  106 bits (254), Expect = 2e-23
 Identities = 46/63 (73%), Positives = 56/63 (88%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSTCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 255 *TP 263
             P
Sbjct: 61  RNP 63


>Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.5 protein.
          Length = 645

 Score =  143 bits (346), Expect = 1e-34
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDA TI+GLN +RIINEPTAAA+AYGLDK    E+NVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTF 205

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSIL+I +G IFEVKSTAGDTH G
Sbjct: 206 DVSILSIAEGSIFEVKSTAGDTHLG 230



 Score =  125 bits (302), Expect = 3e-29
 Identities = 57/86 (66%), Positives = 69/86 (80%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR+F+++TVQ+D KHWPF V    GKP I+V  KGE + F PEE+S+
Sbjct: 62  NPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISA 121

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAE YLG TV++AVIT P
Sbjct: 122 MVLQKMKETAETYLGHTVKDAVITVP 147



 Score =  106 bits (255), Expect = 1e-23
 Identities = 46/63 (73%), Positives = 56/63 (88%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 255 *TP 263
             P
Sbjct: 61  RNP 63


>Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.4 protein.
          Length = 645

 Score =  143 bits (346), Expect = 1e-34
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDA TI+GLN +RIINEPTAAA+AYGLDK    E+NVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTF 205

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSIL+I +G IFEVKSTAGDTH G
Sbjct: 206 DVSILSIAEGSIFEVKSTAGDTHLG 230



 Score =  125 bits (302), Expect = 3e-29
 Identities = 57/86 (66%), Positives = 69/86 (80%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+FDAKRLIGR+F+++TVQ+D KHWPF V    GKP I+V  KGE + F PEE+S+
Sbjct: 62  NPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISA 121

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL KMKETAE YLG TV++AVIT P
Sbjct: 122 MVLQKMKETAETYLGHTVKDAVITVP 147



 Score =  106 bits (255), Expect = 1e-23
 Identities = 46/63 (73%), Positives = 56/63 (88%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 255 *TP 263
             P
Sbjct: 61  RNP 63


>X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.
          Length = 487

 Score =  135 bits (327), Expect = 3e-32
 Identities = 64/84 (76%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLD K  G++ + ++DLGGGTF
Sbjct: 171 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLD-KDAGDKIIAVYDLGGGTF 229

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I+ G+FEVKST GDT  G
Sbjct: 230 DVSILEIQKGVFEVKSTNGDTFLG 253



 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 40/87 (45%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+F  KRLIGR++ED  VQ D+K  P+++V +  G   ++     + K + P +V 
Sbjct: 90  NSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWVEA----QGKEYPPSQVG 145

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE+YLG TV N V+T P
Sbjct: 146 AFVLMKMKETAESYLGTTVNNPVVTVP 172



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 248
           K   +GIDLGTT SCV + +    ++I N +G RTTPS VAFT D ERL+G  AK Q
Sbjct: 30  KGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQ 86


>U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock protein
           protein 6 protein.
          Length = 657

 Score =  135 bits (327), Expect = 3e-32
 Identities = 64/84 (76%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLD K  G++ + ++DLGGGTF
Sbjct: 171 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLD-KDAGDKIIAVYDLGGGTF 229

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I+ G+FEVKST GDT  G
Sbjct: 230 DVSILEIQKGVFEVKSTNGDTFLG 253



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 41/87 (47%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+F  KRLIGR++ED  VQ D+K  P+++V +  G   ++     + K + P +V 
Sbjct: 90  NSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWVEA----QGKVYSPSQVG 145

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE+YLG TV NAV+T P
Sbjct: 146 AFVLMKMKETAESYLGTTVNNAVVTVP 172



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 248
           K   +GIDLGTT SCV + +    ++I N +G RTTPS VAFT D ERL+G  AK Q
Sbjct: 30  KGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQ 86


>Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score =  106 bits (255), Expect = 1e-23
 Identities = 49/84 (58%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DLGGGTF
Sbjct: 143 VPAYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDLGGGTF 202

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+ + ++     VK+  GDTH G
Sbjct: 203 DVAAVNVDGPRITVKAKGGDTHLG 226



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 35/84 (41%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSMV 442
           N++FD KR+IGR+++D  +Q DM  WPF+V   D G P +++    +   F    VSS++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKVEKDDNGIPYLEIHKNEKPLKFSAVTVSSLI 120

Query: 443 LTKMKETAEAYLGKTVQNAVITFP 514
           L  +K  AE  LG  V++AVIT P
Sbjct: 121 LRCLKYNAERKLGLEVKSAVITVP 144



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/55 (50%), Positives = 40/55 (72%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV 251
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVI 56


>Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score =  106 bits (255), Expect = 1e-23
 Identities = 49/84 (58%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DLGGGTF
Sbjct: 143 VPAYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDLGGGTF 202

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+ + ++     VK+  GDTH G
Sbjct: 203 DVAAVNVDGPRITVKAKGGDTHLG 226



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 35/84 (41%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSMV 442
           N++FD KR+IGR+++D  +Q DM  WPF+V   D G P +++    +   F    VSS++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKVEKDDNGIPYLEIHKNEKPLKFSAVTVSSLI 120

Query: 443 LTKMKETAEAYLGKTVQNAVITFP 514
           L  +K  AE  LG  V++AVIT P
Sbjct: 121 LRCLKYNAERKLGLEVKSAVITVP 144



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/55 (50%), Positives = 40/55 (72%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV 251
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVI 56


>Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical
           protein F54C9.2 protein.
          Length = 450

 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 42/83 (50%), Positives = 57/83 (68%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           PA FN+ QR  T  A  I+ + V R+I+EPTAAA+AYGL KK  G  NV++ DLGGGT D
Sbjct: 182 PAEFNEKQRNFTAKAAEIAEMEVRRVISEPTAAALAYGLHKK-QGVENVVVVDLGGGTLD 240

Query: 691 VSILTIEDGIFEVKSTAGDTHFG 759
           VS+L ++ G+F  ++ AG+   G
Sbjct: 241 VSVLWLQGGVFVTQAMAGNNRLG 263



 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFE--DATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEE 427
           NP  TI+DAKR IGR FE  +    +D K +PF++  D  GK   ++      K  +PEE
Sbjct: 94  NPKRTIYDAKRFIGRNFEKNNKDFLSDQKRYPFKINLDSEGKAFFEIPLDSGTKNVYPEE 153

Query: 428 VSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           + S+++  +K  A  +LG T+   VI+ P
Sbjct: 154 IGSLIIGYLKSAAAKHLGVTLGQVVISCP 182



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = +3

Query: 66  KYKMAKAPA--VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER-LIG 230
           KY +   P    GIDLGTTYS +G++    G+  I+ +D G ++ PS VAF      LIG
Sbjct: 25  KYGLPPPPPKIAGIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIG 84

Query: 231 DAAKNQ 248
             A  Q
Sbjct: 85  TRATEQ 90


>L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical
           protein C30C11.4 protein.
          Length = 776

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 5/95 (5%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RN 654
           ++C   VP+YF D QR+A   A   +GLN LRI+NE TA A+AYG+ K+   E     RN
Sbjct: 140 SDCVLAVPSYFTDVQRRAVLSAIQYAGLNSLRIVNETTAIALAYGIYKQDLPEEDAKSRN 199

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           V+  D+G  +   S++    G  ++ +T+ D   G
Sbjct: 200 VVFLDIGHSSTQASLVAFNRGKLQMVNTSYDLESG 234



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 43/131 (32%), Positives = 62/131 (47%), Gaps = 6/131 (4%)
 Frame = +2

Query: 140 AREGGDHRQRPGQQDHSVLCCVH---RHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKFE 310
           AR+GG          H+   CV    + R+     RQ     N  NT+ + K LIGRKF 
Sbjct: 18  ARQGGIEVITNDYSLHATPACVSFGPKDRSMGVAARQAVT-TNIKNTVINFKHLIGRKFS 76

Query: 311 DATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG-- 481
           D   Q  +   P +VV        ++V+Y GE  TF PE+V + +LTK++   E+ L   
Sbjct: 77  DPVAQRFIPFIPCKVVKLPNDDIGVQVSYLGEPHTFTPEQVLAALLTKLRTIVESQLSDV 136

Query: 482 KTVQNAVITFP 514
           K V + V+  P
Sbjct: 137 KKVSDCVLAVP 147



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           +G D+G     +GV + G +E+I ND     TP+ V+F   +R +G AA+  V
Sbjct: 4   LGFDIGNLNCYIGVARQGGIEVITNDYSLHATPACVSFGPKDRSMGVAARQAV 56


>U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical
           protein T24H7.2 protein.
          Length = 925

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/68 (35%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLGG 678
           VP YF  ++R A + A  ++GL VL++IN+ TAAA+++G+  +K  GE+   ++++D+G 
Sbjct: 168 VPVYFTPAERLAVERAAQMAGLTVLQLINDGTAAALSHGIFRRKEIGEKPQRLMVYDMGA 227

Query: 679 GTFDVSIL 702
                +I+
Sbjct: 228 AKTTATIV 235



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           A+ IDLGT +  +G+ + G  ++I  N +  R TP+ V   D  R   DAA
Sbjct: 26  AMTIDLGTQFLKIGIVKPGIPMDIALNTESRRKTPNVVMIQDGHRTFADAA 76


>Z67884-4|CAH60753.1|  905|Caenorhabditis elegans Hypothetical
           protein T14G8.3b protein.
          Length = 905

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 23/59 (38%), Positives = 42/59 (71%), Gaps = 3/59 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLG 675
           VP + N ++R+A   A  I+GLN+L+++N+ +AAA+ YG+  +K   E+  ++LI+D+G
Sbjct: 152 VPIFLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMG 210



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = +2

Query: 290 LIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETA 466
           +I RK  D       K +PF     D  +  +   YK E+K +  E + +M+L   K+  
Sbjct: 80  MIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFPYK-EEK-YNVETLLAMILWNAKKVT 137

Query: 467 EAYLGKTVQNAVITFP 514
           EAY  +TV++ VIT P
Sbjct: 138 EAYADQTVKDVVITVP 153


>Z67884-3|CAA91809.2|  921|Caenorhabditis elegans Hypothetical
           protein T14G8.3a protein.
          Length = 921

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 23/59 (38%), Positives = 42/59 (71%), Gaps = 3/59 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLG 675
           VP + N ++R+A   A  I+GLN+L+++N+ +AAA+ YG+  +K   E+  ++LI+D+G
Sbjct: 168 VPIFLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMG 226



 Score = 35.1 bits (77), Expect = 0.055
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = +2

Query: 290 LIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETA 466
           +I RK  D       K +PF     D  +  +   YK E+K +  E + +M+L   K+  
Sbjct: 96  MIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFPYK-EEK-YNVETLLAMILWNAKKVT 153

Query: 467 EAYLGKTVQNAVITFP 514
           EAY  +TV++ VIT P
Sbjct: 154 EAYADQTVKDVVITVP 169


>AF022979-6|ABD94088.1|   94|Caenorhabditis elegans Hypothetical
           protein T02B11.8 protein.
          Length = 94

 Score = 31.5 bits (68), Expect = 0.67
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -2

Query: 269 CCWGSRHLVLGGISDETLGVCERNIRRSGPVA 174
           CC G+ H    G S  T+G C+R    S PV+
Sbjct: 58  CCPGTNHCCPPGFSCTTIGTCKRTTTLSNPVS 89


>Z81136-5|CAB03460.2|  733|Caenorhabditis elegans Hypothetical
           protein W02B8.4 protein.
          Length = 733

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 20/76 (26%), Positives = 38/76 (50%)
 Frame = +2

Query: 269 TIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLT 448
           T+  AKR I R  E  T+++D    PF +++      +K A K +D+     +   ++L 
Sbjct: 205 TVRRAKRSIIRNAESYTLKSDFDKSPFSIITKHLTNSVK-ALKKKDRI---SKWQDIILR 260

Query: 449 KMKETAEAYLGKTVQN 496
             KE+++    K ++N
Sbjct: 261 IQKESSQLRKRKEIEN 276


>AL117204-6|CAB55149.2|  833|Caenorhabditis elegans Hypothetical
           protein Y116A8C.13 protein.
          Length = 833

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = +1

Query: 145 GRWRSSPTTR-ATGPLRLMLRSQTPSVSSEMPPRT 246
           G W      R ATGP +  + +Q P + S MPP T
Sbjct: 84  GSWSVEIQERIATGPPQKPISAQKPEIQSPMPPMT 118


>AF078792-4|AAN84813.1|  261|Caenorhabditis elegans Hypothetical
           protein Y40D12A.1b protein.
          Length = 261

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 17/75 (22%), Positives = 27/75 (36%)
 Frame = +2

Query: 170 PGQQDHSVLCCVHRHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPF 349
           PG    +V   + R R  +        G N  N  F+ +    +  +D+ ++  M  W F
Sbjct: 131 PGYFIEAVHVALMRSRGKNEEMSYWKWGANTLNPYFENRSCFDKLIDDSHIRPTMDQWYF 190

Query: 350 EVVSDGGKPKIKVAY 394
               DG   K    Y
Sbjct: 191 GPSDDGDIEKFTEEY 205


>AF078792-3|AAC26945.2|  635|Caenorhabditis elegans Hypothetical
           protein Y40D12A.1a protein.
          Length = 635

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 17/75 (22%), Positives = 27/75 (36%)
 Frame = +2

Query: 170 PGQQDHSVLCCVHRHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPF 349
           PG    +V   + R R  +        G N  N  F+ +    +  +D+ ++  M  W F
Sbjct: 131 PGYFIEAVHVALMRSRGKNEEMSYWKWGANTLNPYFENRSCFDKLIDDSHIRPTMDQWYF 190

Query: 350 EVVSDGGKPKIKVAY 394
               DG   K    Y
Sbjct: 191 GPSDDGDIEKFTEEY 205


>Z92864-3|CAB07434.1|   48|Caenorhabditis elegans Hypothetical
           protein Y65A5A.3 protein.
          Length = 48

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -2

Query: 755 KWVSPAVDFTSKIPS-SMVRMDTSKVPPPRSKISTFRS 645
           +W+  A  F  + P+ S++     + PPP SKIS  RS
Sbjct: 10  RWMQTASRFVDEYPNFSVLPPPPLRAPPPHSKISDRRS 47


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,158,465
Number of Sequences: 27780
Number of extensions: 440463
Number of successful extensions: 1551
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1355
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1529
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1809061256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -