SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z83232-1|CAB05755.3| 1764|Caenorhabditis elegans Hypothetical pr...    83   2e-16
AB162421-1|BAD36749.1| 1766|Caenorhabditis elegans plexin protein.     83   2e-16
AC024825-1|ABA00169.1| 1908|Caenorhabditis elegans Plexin protei...    73   2e-13
AB080022-1|BAB85224.1| 1951|Caenorhabditis elegans plexin A prot...    73   2e-13
Z81484-2|CAB03970.2|  334|Caenorhabditis elegans Hypothetical pr...    30   1.3  
AB275891-1|BAF34314.1|  334|Caenorhabditis elegans D-aspartate o...    30   1.3  
Z98866-13|CAB11552.1|  327|Caenorhabditis elegans Hypothetical p...    28   7.0  
U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical pr...    28   7.0  
Z78413-3|CAB01659.1|  202|Caenorhabditis elegans Hypothetical pr...    27   9.3  
AL032663-11|CAE18008.2|  124|Caenorhabditis elegans Hypothetical...    27   9.3  
AF016420-4|AAB65308.1|  703|Caenorhabditis elegans Na/ca exchang...    27   9.3  

>Z83232-1|CAB05755.3| 1764|Caenorhabditis elegans Hypothetical protein
            K04B12.1 protein.
          Length = 1764

 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 34/83 (40%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQ-DEFDEKVQCKV 187
            F L+KA+++Q +KG VDA+T +ARY+++E KLL+E +D +T+ + ++  ++ DE +  +V
Sbjct: 1331 FYLYKALQYQTDKGPVDAVTGDARYTINEAKLLRESVDTKTLKIRVIPFEKCDESIDLEV 1390

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
              CD+I QVK K+  A+++ TP+
Sbjct: 1391 HACDAICQVKQKVASAVYRETPY 1413


>AB162421-1|BAD36749.1| 1766|Caenorhabditis elegans plexin protein.
          Length = 1766

 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 34/83 (40%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQ-DEFDEKVQCKV 187
            F L+KA+++Q +KG VDA+T +ARY+++E KLL+E +D +T+ + ++  ++ DE +  +V
Sbjct: 1333 FYLYKALQYQTDKGPVDAVTGDARYTINEAKLLRESVDTKTLKIRVIPFEKCDESIDLEV 1392

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
              CD+I QVK K+  A+++ TP+
Sbjct: 1393 HACDAICQVKQKVASAVYRETPY 1415


>AC024825-1|ABA00169.1| 1908|Caenorhabditis elegans Plexin protein 1
            protein.
          Length = 1908

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 4/84 (4%)
 Frame = +2

Query: 17   LFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDE----FDEKVQCK 184
            LF  IK Q+EKG  DA+T EARYSLSEEKLL+   +Y+ + + +   +      + +  +
Sbjct: 1485 LFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVR 1544

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VLDCD+I+QVK K LDA ++   F
Sbjct: 1545 VLDCDTITQVKEKCLDAKYRGYRF 1568



 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query: 247  YSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNG-WRKLNTLAHYGVKESAIMSLI 423
            Y  + RPA  +++LEW+ G  G + LQD D +++   G W++LNTLAHY V  +AI++L 
Sbjct: 1566 YRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKRLNTLAHYNVPNNAILTLT 1625

Query: 424  SRQNDSFN 447
            S+ N  +N
Sbjct: 1626 SKSNSLYN 1633



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 528  TDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLTGCYLLK 656
            TD     YHLVKP E+       ++   K + EI+LT   ++K
Sbjct: 1676 TDNGFKLYHLVKPTEH-----GPTDSQEKMVTEIYLTRLLMMK 1713


>AB080022-1|BAB85224.1| 1951|Caenorhabditis elegans plexin A protein.
          Length = 1951

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 4/84 (4%)
 Frame = +2

Query: 17   LFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDE----FDEKVQCK 184
            LF  IK Q+EKG  DA+T EARYSLSEEKLL+   +Y+ + + +   +      + +  +
Sbjct: 1491 LFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVR 1550

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VLDCD+I+QVK K LDA ++   F
Sbjct: 1551 VLDCDTITQVKEKCLDAKYRGYRF 1574



 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query: 247  YSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNG-WRKLNTLAHYGVKESAIMSLI 423
            Y  + RPA  +++LEW+ G  G + LQD D +++   G W++LNTLAHY V  +AI++L 
Sbjct: 1572 YRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKRLNTLAHYNVPNNAILTLT 1631

Query: 424  SRQNDSFN 447
            S+ N  +N
Sbjct: 1632 SKSNSLYN 1639



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +3

Query: 528  TDQNVHYYHLVKPIEYQHIVNKSSEHSHKAIPEIFLTGCYLLK 656
            TD     YHLVKP E+       ++   K + EI+LT   ++K
Sbjct: 1682 TDNGFKLYHLVKPTEH-----GPTDSQEKMVTEIYLTRLLMMK 1719


>Z81484-2|CAB03970.2|  334|Caenorhabditis elegans Hypothetical
           protein C47A10.5 protein.
          Length = 334

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +1

Query: 223 DTRCSLQKYSISLRPAVHEVDL--EWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYG 393
           D +  L++Y ++L PA+ E  +  EW   R    T++ E V  K+    +K   + HYG
Sbjct: 248 DRKDILERY-VALHPAMREPKILGEWSGLRPARKTIRIEKVEKKSEKSGKKYTVVHHYG 305


>AB275891-1|BAF34314.1|  334|Caenorhabditis elegans D-aspartate
           oxidase protein.
          Length = 334

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +1

Query: 223 DTRCSLQKYSISLRPAVHEVDL--EWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYG 393
           D +  L++Y ++L PA+ E  +  EW   R    T++ E V  K+    +K   + HYG
Sbjct: 248 DRKDILERY-VALHPAMREPKILGEWSGLRPARKTIRIEKVEKKSEKSGKKYTVVHHYG 305


>Z98866-13|CAB11552.1|  327|Caenorhabditis elegans Hypothetical
           protein Y49E10.16 protein.
          Length = 327

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 433 NDSFNTPYKIPCKNCTGIYCSNSHIPYT 516
           N +   PY++ C    G+YCSN ++ Y+
Sbjct: 280 NMTIGQPYQL-CAEADGLYCSNRNLDYS 306


>U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical protein
            C25H3.8 protein.
          Length = 2148

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 12/50 (24%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +1

Query: 205  ITSKIEDTRCSLQKYSISLRPAVHEVDLEWRHGR-GGHVTLQDEDVTTKT 351
            ++  +E   C+L  Y +   P +   +L W+  R  G V  Q + + T++
Sbjct: 940  VSVPLEFAHCTLTAYPVGPMPVIEHAELSWKSVRISGEVCNQTQRLKTRS 989


>Z78413-3|CAB01659.1|  202|Caenorhabditis elegans Hypothetical
           protein T01C3.3 protein.
          Length = 202

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 5/104 (4%)
 Frame = +1

Query: 214 KIEDTRCSLQKYSISLRPAVHEVDLEWRH---GRGGHVTLQDEDVTTKT--LNGWRKLNT 378
           ++++T   L K S  L+    ++  E       R  H  LQ+E   +K   +    KLN 
Sbjct: 45  RLDETERKLAKTSAELKAKDEKLKKETASLEASREAHRLLQEESNKSKVSVMRLTFKLNR 104

Query: 379 LAHYGVKESAIMSLISRQNDSFNTPYKIPCKNCTGIYCSNSHIP 510
           + H  VKE A++       ++    Y   C  C   +  N+ IP
Sbjct: 105 ITHESVKEQAVLKKKLLDCETRLATYS-ECLVCYQKFDENTRIP 147


>AL032663-11|CAE18008.2|  124|Caenorhabditis elegans Hypothetical
           protein Y75B12B.11 protein.
          Length = 124

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 1/66 (1%)
 Frame = +1

Query: 214 KIEDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDED-VTTKTLNGWRKLNTLAHY 390
           K E+  CSLQK     +PAV E D   +          D D V +K    +R  N    Y
Sbjct: 29  KCENANCSLQKTGEEFKPAVCEKDSNGKIACDIECDKADRDSVISKRPTDYRYCNRFYTY 88

Query: 391 GVKESA 408
             ++++
Sbjct: 89  NAEKTS 94


>AF016420-4|AAB65308.1|  703|Caenorhabditis elegans Na/ca exchangers
           protein 8 protein.
          Length = 703

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 10/33 (30%), Positives = 21/33 (63%)
 Frame = +2

Query: 188 LDCDSISQVKSKILDALFKNTPFHSDLLSMKLI 286
           LD D ++  +++++  +F+N    +DL SMK +
Sbjct: 348 LDADELTLKRNRMISLIFRNKTLDTDLESMKTL 380


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,374,739
Number of Sequences: 27780
Number of extensions: 284338
Number of successful extensions: 761
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 721
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 755
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1539654388
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -