SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20053
         (739 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U00037-1|AAA50661.2|  495|Caenorhabditis elegans Adenosine deami...    29   3.4  
AF051275-1|AAC25097.1|  495|Caenorhabditis elegans putative RNA ...    29   3.4  
Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical p...    28   7.9  
Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical pr...    28   7.9  
AL033514-12|CAA22099.1|  208|Caenorhabditis elegans Hypothetical...    28   7.9  
AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein.      28   7.9  

>U00037-1|AAA50661.2|  495|Caenorhabditis elegans Adenosine
           deaminase that acts onrna protein 2 protein.
          Length = 495

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +2

Query: 134 DVSFPSKILKKTSFSHSVDVLSCVKQSVVYPLKYK 238
           D++ PS++ KK      + + +  K SV YP+ Y+
Sbjct: 420 DITTPSRLCKKNMAELMITICTLTKTSVDYPISYE 454


>AF051275-1|AAC25097.1|  495|Caenorhabditis elegans putative RNA
           adenosine deaminase protein.
          Length = 495

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +2

Query: 134 DVSFPSKILKKTSFSHSVDVLSCVKQSVVYPLKYK 238
           D++ PS++ KK      + + +  K SV YP+ Y+
Sbjct: 420 DITTPSRLCKKNMAELMITICTLTKTSVDYPISYE 454


>Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical
            protein C02F4.1 protein.
          Length = 1781

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = -2

Query: 342  DFFLLHPKILHKNINFVLFR-RVFYGSFRFC 253
            D  +L  K++HK++ FV+   + F+ + +FC
Sbjct: 994  DMIMLQNKVIHKSLRFVMSAVQTFFSNDKFC 1024


>Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical protein
            C02F4.1 protein.
          Length = 1781

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = -2

Query: 342  DFFLLHPKILHKNINFVLFR-RVFYGSFRFC 253
            D  +L  K++HK++ FV+   + F+ + +FC
Sbjct: 994  DMIMLQNKVIHKSLRFVMSAVQTFFSNDKFC 1024


>AL033514-12|CAA22099.1|  208|Caenorhabditis elegans Hypothetical
           protein Y75B8A.11 protein.
          Length = 208

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = -2

Query: 309 KNINFVLFRRVFYGSFRFCSNAKNLYFNG*TT 214
           KN++F LF R FY +   C++ KN+     T+
Sbjct: 104 KNVSFSLFFRAFYLTVPACTSKKNVLLTSTTS 135


>AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein.
          Length = 1781

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = -2

Query: 342  DFFLLHPKILHKNINFVLFR-RVFYGSFRFC 253
            D  +L  K++HK++ FV+   + F+ + +FC
Sbjct: 994  DMIMLQNKVIHKSLRFVMSAVQTFFSNDKFC 1024


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,413,808
Number of Sequences: 27780
Number of extensions: 277669
Number of successful extensions: 612
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 594
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 612
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1735436670
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -