SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79752-3|CAB02078.2|  130|Caenorhabditis elegans Hypothetical pr...    65   5e-11
AF040651-1|AAB95013.4|  691|Caenorhabditis elegans Nhl (ring fin...    31   1.0  

>Z79752-3|CAB02078.2|  130|Caenorhabditis elegans Hypothetical
           protein D2005.3 protein.
          Length = 130

 Score = 64.9 bits (151), Expect = 5e-11
 Identities = 38/98 (38%), Positives = 56/98 (57%)
 Frame = +3

Query: 186 QSTTRKNASNGTS*THYIESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCK 365
           Q+  ++ A NG      I     Q A  RL+ + + +PEKA M+E  +  MA+ GQ+  K
Sbjct: 36  QAENQETAKNGM-----ISQILDQAAMQRLSNLAVAKPEKAQMVEAALINMARRGQLSGK 90

Query: 366 ITEPDLIQILESFNQQMPKSQSTVKFDRRRAALDSDDE 479
           +T+  L  ++E  + Q  K+ S VKFDRRR  LDSD+E
Sbjct: 91  MTDDGLKALMERVSAQTQKATS-VKFDRRRNELDSDEE 127


>AF040651-1|AAB95013.4|  691|Caenorhabditis elegans Nhl (ring finger
           b-box coiled coil)domain containing protein 3 protein.
          Length = 691

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = -2

Query: 98  ILKQFIVFSGSQFTTNQLIFCESCT*VPCSSC 3
           I ++ +V S S   T+QL++CE+C  V C +C
Sbjct: 102 IQRKDVVPSCSNHPTDQLLYCETCDLVFCENC 133


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,449,102
Number of Sequences: 27780
Number of extensions: 248342
Number of successful extensions: 464
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 451
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 463
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1560745544
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -