SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical pr...   137   9e-33
M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation fact...   137   9e-33
Z83235-9|CAI79209.1|  705|Caenorhabditis elegans Hypothetical pr...    60   2e-09
Z83235-8|CAB05774.2|  894|Caenorhabditis elegans Hypothetical pr...    60   2e-09
U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation fact...    51   1e-06
M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.        51   1e-06
Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical pr...    49   3e-06
L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical pr...    49   4e-06
AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical ...    48   8e-06
D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation fact...    37   0.019
D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation fact...    37   0.019
AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongatio...    37   0.019
AL132862-30|CAB60565.3|  716|Caenorhabditis elegans Hypothetical...    35   0.075
U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation f...    34   0.13 
AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial...    34   0.13 
U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation fact...    33   0.30 
U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation fact...    33   0.30 
U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation fact...    33   0.30 
U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation fact...    33   0.30 
U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation fact...    33   0.30 
Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical p...    31   0.70 
U67956-2|AAB07691.2| 1254|Caenorhabditis elegans Dumpy : shorter...    31   0.92 
Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical pr...    31   1.2  
U41992-4|AAL02506.2|  876|Caenorhabditis elegans Hypothetical pr...    31   1.2  
U39996-6|AAA81092.1|  595|Caenorhabditis elegans Hypothetical pr...    31   1.2  
AL009246-7|CAA15840.2|  347|Caenorhabditis elegans Hypothetical ...    30   2.1  
AF000264-4|AAC71125.3|  631|Caenorhabditis elegans Hypothetical ...    30   2.1  
Z74472-5|CAA98943.1|  802|Caenorhabditis elegans Hypothetical pr...    29   3.7  
U53333-5|AAA96158.2| 1852|Caenorhabditis elegans Amanitin resist...    29   3.7  
M29235-1|AAA28126.1| 1859|Caenorhabditis elegans protein ( C.ele...    29   3.7  
Z83225-2|CAB05722.1|  732|Caenorhabditis elegans Hypothetical pr...    29   4.9  
Z81097-19|CAB03177.1|  732|Caenorhabditis elegans Hypothetical p...    29   4.9  
Z69792-3|CAA93666.1|  284|Caenorhabditis elegans Hypothetical pr...    29   4.9  
U41027-7|AAP46276.1| 1465|Caenorhabditis elegans Hypothetical pr...    29   4.9  
U41027-6|AAC48194.5| 1512|Caenorhabditis elegans Hypothetical pr...    29   4.9  
Z81143-5|CAB03518.2|  370|Caenorhabditis elegans Hypothetical pr...    28   6.5  
AL031627-6|CAA20958.1|  338|Caenorhabditis elegans Hypothetical ...    28   6.5  
AC084161-1|ABD63205.1| 1375|Caenorhabditis elegans Hypothetical ...    28   6.5  
Z92815-4|CAB07294.2| 2175|Caenorhabditis elegans Hypothetical pr...    28   8.6  
Z73098-4|CAD44145.1|  565|Caenorhabditis elegans Hypothetical pr...    28   8.6  
Z73098-3|CAD44144.1|  501|Caenorhabditis elegans Hypothetical pr...    28   8.6  
AF040652-7|AAB95017.1|  210|Caenorhabditis elegans Hypothetical ...    28   8.6  

>Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical
           protein F25H5.4 protein.
          Length = 852

 Score =  137 bits (331), Expect = 9e-33
 Identities = 66/102 (64%), Positives = 73/102 (71%), Gaps = 1/102 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+LFMNKMDR            +QTFQRIVEN+NVIIA
Sbjct: 143 CVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIA 202

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           TY DD GPMG + VDPS G+VGFGSGLHGWAFTLKQF+EMYA
Sbjct: 203 TYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYA 244



 Score =  128 bits (310), Expect = 3e-30
 Identities = 60/66 (90%), Positives = 65/66 (98%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVDEIR +MD+KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG++AGETRFTDTR
Sbjct: 1   MVNFTVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66



 Score =  111 bits (267), Expect = 5e-25
 Identities = 63/93 (67%), Positives = 68/93 (73%), Gaps = 8/93 (8%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQRE------KSEK--GFLINLIDSPGHVDFSSE 410
           CITIKSTAIS+FFELE+KDL F+   +Q E      K EK  GFLINLIDSPGHVDFSSE
Sbjct: 67  CITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSE 126

Query: 411 VTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           VTAALRVTDGAL           QTETVLRQA+
Sbjct: 127 VTAALRVTDGALVVVDCVSGVCVQTETVLRQAI 159


>M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation factor
           protein.
          Length = 852

 Score =  137 bits (331), Expect = 9e-33
 Identities = 66/102 (64%), Positives = 73/102 (71%), Gaps = 1/102 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+LFMNKMDR            +QTFQRIVEN+NVIIA
Sbjct: 143 CVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIA 202

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           TY DD GPMG + VDPS G+VGFGSGLHGWAFTLKQF+EMYA
Sbjct: 203 TYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYA 244



 Score =  128 bits (310), Expect = 3e-30
 Identities = 60/66 (90%), Positives = 65/66 (98%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVDEIR +MD+KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG++AGETRFTDTR
Sbjct: 1   MVNFTVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66



 Score =  108 bits (260), Expect = 4e-24
 Identities = 62/93 (66%), Positives = 67/93 (72%), Gaps = 8/93 (8%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQRE------KSEK--GFLINLIDSPGHVDFSSE 410
           CITIKSTAIS+FFELE+KDL F+   +Q E      K EK  GFLINLIDSPGHVDFSSE
Sbjct: 67  CITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSE 126

Query: 411 VTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           VTAAL VTDGAL           QTETVLRQA+
Sbjct: 127 VTAALGVTDGALVVVDCVSGVCVQTETVLRQAI 159


>Z83235-9|CAI79209.1|  705|Caenorhabditis elegans Hypothetical
           protein K10C3.5b protein.
          Length = 705

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 25/49 (51%), Positives = 37/49 (75%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +IRN+ ++AHVDHGK++  DSLVS   +I+   AG+ R+ D+R+DEQ R
Sbjct: 19  HIRNVCLVAHVDHGKTSFADSLVSANAVISSRMAGKLRYMDSREDEQTR 67



 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = +3

Query: 363 LINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSL 527
           LINLIDSPGHVDFS EVT+AL ++D AL           QTE ++RQ + +  ++
Sbjct: 84  LINLIDSPGHVDFSGEVTSALILSDIALLLIDVIEGICSQTEALIRQVIRNGQAM 138



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 11/95 (11%)
 Frame = +2

Query: 527 ILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY-------NDDGGPMGE----V 673
           IL +NK+DR            YQ   R++E VN  I+         +D  G + E    +
Sbjct: 139 ILVINKIDRLRVELKMSSSEAYQHMSRLIEGVNSCISQVLGGIVLEDDTWGNIEESEAKL 198

Query: 674 RVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
             DP+KG+V F S LH +AF  + F+++ A   ++
Sbjct: 199 HFDPAKGNVIFSSALHSYAFGCEDFAQIAAEKMKV 233


>Z83235-8|CAB05774.2|  894|Caenorhabditis elegans Hypothetical
           protein K10C3.5a protein.
          Length = 894

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 25/49 (51%), Positives = 37/49 (75%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +IRN+ ++AHVDHGK++  DSLVS   +I+   AG+ R+ D+R+DEQ R
Sbjct: 19  HIRNVCLVAHVDHGKTSFADSLVSANAVISSRMAGKLRYMDSREDEQTR 67



 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = +3

Query: 363 LINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSL 527
           LINLIDSPGHVDFS EVT+AL ++D AL           QTE ++RQ + +  ++
Sbjct: 84  LINLIDSPGHVDFSGEVTSALILSDIALLLIDVIEGICSQTEALIRQVIRNGQAM 138



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 11/95 (11%)
 Frame = +2

Query: 527 ILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY-------NDDGGPMGE----V 673
           IL +NK+DR            YQ   R++E VN  I+         +D  G + E    +
Sbjct: 139 ILVINKIDRLRVELKMSSSEAYQHMSRLIEGVNSCISQVLGGIVLEDDTWGNIEESEAKL 198

Query: 674 RVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
             DP+KG+V F S LH +AF  + F+++ A   ++
Sbjct: 199 HFDPAKGNVIFSSALHSYAFGCEDFAQIAAEKMKV 233


>U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation factor
           protein 1 protein.
          Length = 974

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 26/65 (40%), Positives = 37/65 (56%)
 Frame = +3

Query: 315 VFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           V I   D R KS   +L+N+ID+PGHV+FS E+TA+ R+ DG +            TE  
Sbjct: 189 VSIVAQDSRSKS---YLLNIIDTPGHVNFSDEMTASYRLADGVVVMVDAHEGVMMNTERA 245

Query: 495 LRQAM 509
           +R A+
Sbjct: 246 IRHAI 250



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 25/84 (29%), Positives = 43/84 (51%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   L ++K+DR            Y   + I++ VN I++T+ ++  P+    + P  
Sbjct: 252 ERLAVTLCISKIDRLLLELKLPPADAYFKLRLIIDQVNNILSTFAEEDVPV----LSPLN 307

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F SG +   F+L  FS +YA
Sbjct: 308 GNVIFSSGRYNVCFSLLSFSNIYA 331



 Score = 35.9 bits (79), Expect = 0.032
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +1

Query: 91  MMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA-GIIAGARAGETRFTDTRKDEQDRASPL 267
           +MD    +RN+++  H+ HGK+T  D L+ +       A   + RFTD    E+ R   +
Sbjct: 125 LMDCPHIMRNVAIAGHLHHGKTTFLDCLMEQTHPEFYRAEDADARFTDILFIEKQRGCSI 184

Query: 268 NLRP 279
             +P
Sbjct: 185 KSQP 188


>M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.
          Length = 849

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 26/65 (40%), Positives = 37/65 (56%)
 Frame = +3

Query: 315 VFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           V I   D R KS   +L+N+ID+PGHV+FS E+TA+ R+ DG +            TE  
Sbjct: 64  VSIVAQDSRSKS---YLLNIIDTPGHVNFSDEMTASYRLADGVVVMVDAHEGVMMNTERA 120

Query: 495 LRQAM 509
           +R A+
Sbjct: 121 IRHAI 125



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 25/84 (29%), Positives = 43/84 (51%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   L ++K+DR            Y   + I++ VN I++T+ ++  P+    + P  
Sbjct: 127 ERLAVTLCISKIDRLLLELKLPPADAYFKLRLIIDQVNNILSTFAEEDVPV----LSPLN 182

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F SG +   F+L  FS +YA
Sbjct: 183 GNVIFSSGRYNVCFSLLSFSNIYA 206



 Score = 35.1 bits (77), Expect = 0.057
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA-GIIAGARAGETRFTDTRKDEQDRASPLN 270
           MD    +RN+++  H+ HGK+T  D L+ +       A   + RFTD    E+ R   + 
Sbjct: 1   MDCPHIMRNVAIAGHLHHGKTTFLDCLMEQTHPEFYRAEDADARFTDILFIEKQRGCSIK 60

Query: 271 LRP 279
            +P
Sbjct: 61  SQP 63


>Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical
           protein F29C12.4 protein.
          Length = 750

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 26/49 (53%), Positives = 30/49 (61%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           G  IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV RQ
Sbjct: 111 GTNINIIDTPGHVDFTVEVERALRVLDGAVLVLCGVGGVQSQTFTVNRQ 159



 Score = 32.7 bits (71), Expect = 0.30
 Identities = 13/28 (46%), Positives = 21/28 (75%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           IRN+ + AH+D GK+T+T+ ++  AG I
Sbjct: 44  IRNIGISAHIDSGKTTVTERILYYAGRI 71


>L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical
           protein ZK1236.1 protein.
          Length = 645

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 20/31 (64%), Positives = 27/31 (87%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +G+L+NLID+PGHVDFS+EV+ +L V DG L
Sbjct: 100 RGYLLNLIDTPGHVDFSAEVSRSLAVCDGIL 130



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN  ++AHVDHGKSTL D L+   G +     G+ +  D  + E++R
Sbjct: 42  IRNFGIVAHVDHGKSTLADRLLEMCGAVP---PGQKQMLDKLQVERER 86


>AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical
           protein Y119D3B.14 protein.
          Length = 689

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 25/51 (49%), Positives = 29/51 (56%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG  INLID+PGHVDF  EV   +RV DG +           QT TV RQ+
Sbjct: 88  KGHRINLIDTPGHVDFRVEVERCVRVLDGIVVVIDGSAGVQPQTLTVWRQS 138



 Score = 36.3 bits (80), Expect = 0.025
 Identities = 16/28 (57%), Positives = 22/28 (78%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           +RN+ VIAHVD GK+T+T+ L+  AG I
Sbjct: 25  LRNIGVIAHVDAGKTTVTERLLYLAGAI 52


>D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 495

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 51  NVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITIN 101


>D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 496

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 52  NVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITIN 102


>AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 1 protein.
          Length = 496

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 52  NVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITIN 102


>AL132862-30|CAB60565.3|  716|Caenorhabditis elegans Hypothetical
           protein Y73F8A.1 protein.
          Length = 716

 Score = 34.7 bits (76), Expect = 0.075
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 1/101 (0%)
 Frame = +1

Query: 43  HKPSKMVNFTVDEIRGMMDKKRN-IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGET 219
           H P K+     DE+  M ++KRN + N    A+++     + +S+ S    I G  A   
Sbjct: 610 HVPEKVAEDIADEVARMTEQKRNYMENHRDYANLNRRVDQMQESVFSIVDRIEGVNATLQ 669

Query: 220 RFTDTRKDEQDRASPLNLRPSLCSSSLKRKI*YSSQTLTSV 342
                R  +QD  + ++L   L +    R+      T+TS+
Sbjct: 670 TIEKQRVQQQDGGNLMDLSALLTNQVRNRESAARRPTITSI 710


>U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 2 protein.
          Length = 439

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 19/63 (30%), Positives = 31/63 (49%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSS 297
           N+  I H+DHGK+TLT ++         A+  +    D  K+E+ R   +N+      S 
Sbjct: 47  NVGTIGHIDHGKTTLTSAITRVQAKKGFAKHIKFDEIDKGKEEKKRGITINVAHIGYESP 106

Query: 298 LKR 306
           L+R
Sbjct: 107 LRR 109


>AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial
           elongation factorTu homologue protein.
          Length = 439

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 19/63 (30%), Positives = 31/63 (49%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSS 297
           N+  I H+DHGK+TLT ++         A+  +    D  K+E+ R   +N+      S 
Sbjct: 47  NVGTIGHIDHGKTTLTSAITRVQAKKGFAKHIKFDEIDKGKEEKKRGITINVAHIGYESP 106

Query: 298 LKR 306
           L+R
Sbjct: 107 LRR 109


>U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation factor
           protein 4, isoformc protein.
          Length = 267

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCG 32


>U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation factor
           protein 4, isoformb protein.
          Length = 77

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCG 32


>U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation factor
           protein 4, isoformd protein.
          Length = 429

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCG 32


>U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation factor
           protein 4, isoforma protein.
          Length = 463

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCG 32


>U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation factor
           protein 3 protein.
          Length = 463

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCG 32


>Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical
           protein F46B6.6a protein.
          Length = 702

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +1

Query: 97  DKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           D +R    ++++ HVDHGK+TL D++   + I AG   G T+
Sbjct: 151 DLERRPPIVTIMGHVDHGKTTLLDAM-RNSQIAAGEFGGITQ 191


>U67956-2|AAB07691.2| 1254|Caenorhabditis elegans Dumpy : shorter
           than wild-typeprotein 6 protein.
          Length = 1254

 Score = 31.1 bits (67), Expect = 0.92
 Identities = 16/62 (25%), Positives = 26/62 (41%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVMN 317
           ++  + T   +T STT+  P +T +  + +E   T    S+     P  L  RW   V  
Sbjct: 697 ASTGIITTDEETTSTTSTTPEITSTKEIVTESAITQTSVSVVESSTPRQLPERWKAIVNK 756

Query: 316 TK 311
            K
Sbjct: 757 FK 758


>Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical
           protein C30H6.11 protein.
          Length = 460

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRS-AAVTSEEKSTCPGESIKLIKKP 356
           +T +  T T  T +TTT  P+ T + A  TSE  +T P  + +   KP
Sbjct: 222 TTPTTTTTTTTTPTTTTTTPTTTTTPATTTSETTTTTPTTTTQTTTKP 269


>U41992-4|AAL02506.2|  876|Caenorhabditis elegans Hypothetical
           protein F32E10.3 protein.
          Length = 876

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKK 359
           +T +  T   +  +TTT APS T +  VT   K   P E  KL+KK
Sbjct: 764 TTAAPSTKPAEETTTTTEAPSTT-TKPVTVAVKKVSPEEMEKLVKK 808


>U39996-6|AAA81092.1|  595|Caenorhabditis elegans Hypothetical
           protein C56E6.5 protein.
          Length = 595

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 21/65 (32%), Positives = 31/65 (47%)
 Frame = +1

Query: 124 SVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSSLK 303
           +++   D GK+TL ++L S AG   G  A   +F  TR+      S +N R    SS   
Sbjct: 51  AIVGVADSGKTTLLEALTSGAGGDIGGIAMLDKFMLTRRRFNKFCSHINYRNQYPSSLSV 110

Query: 304 RKI*Y 318
           R + Y
Sbjct: 111 RSLLY 115


>AL009246-7|CAA15840.2|  347|Caenorhabditis elegans Hypothetical
           protein C47F8.8 protein.
          Length = 347

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = -3

Query: 473 HTRHTVNNHKGSISDTECSCYFRREINV 390
           H   T   H G IS T C+ +FRR I +
Sbjct: 15  HNTETTRRHFGIISCTACAAFFRRSIGM 42


>AF000264-4|AAC71125.3|  631|Caenorhabditis elegans Hypothetical
           protein F43E2.3 protein.
          Length = 631

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = -1

Query: 466 DTQSTTTRAPSVTRSAAVTSEEKSTCPGESIK 371
           D+ +T  R+P  TRS ++TS +   C G+ I+
Sbjct: 174 DSANTILRSPYSTRSDSITSVDSGQCSGDQIE 205


>Z74472-5|CAA98943.1|  802|Caenorhabditis elegans Hypothetical
           protein F23H12.5 protein.
          Length = 802

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCP 386
           ST +  T T  T +TTT AP+ T +   T+E     P
Sbjct: 210 STSTTTTTTTSTTTTTTEAPTTTTTIKTTTESIEPIP 246


>U53333-5|AAA96158.2| 1852|Caenorhabditis elegans Amanitin resistant
           protein 1 protein.
          Length = 1852

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/21 (52%), Positives = 11/21 (52%)
 Frame = -1

Query: 145 DRRGRSQTCCGYSASCPSSHG 83
           DRRGR  TC G    CP   G
Sbjct: 61  DRRGRCMTCAGNLTDCPGHFG 81


>M29235-1|AAA28126.1| 1859|Caenorhabditis elegans protein (
           C.elegans RNA polymeraseII largest subunit (ama-1 IV)
           gene, complete cds. ).
          Length = 1859

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/21 (52%), Positives = 11/21 (52%)
 Frame = -1

Query: 145 DRRGRSQTCCGYSASCPSSHG 83
           DRRGR  TC G    CP   G
Sbjct: 61  DRRGRCMTCAGNLTDCPGHFG 81


>Z83225-2|CAB05722.1|  732|Caenorhabditis elegans Hypothetical
           protein F42H11.2 protein.
          Length = 732

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 60  GEFHGRRDPWDDGQEAEYPQHVCDR 134
           GEFHG    WD+  ++EY   + DR
Sbjct: 666 GEFHGTTKSWDNITKSEYGTFLLDR 690


>Z81097-19|CAB03177.1|  732|Caenorhabditis elegans Hypothetical
           protein F42H11.2 protein.
          Length = 732

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 60  GEFHGRRDPWDDGQEAEYPQHVCDR 134
           GEFHG    WD+  ++EY   + DR
Sbjct: 666 GEFHGTTKSWDNITKSEYGTFLLDR 690


>Z69792-3|CAA93666.1|  284|Caenorhabditis elegans Hypothetical
           protein F40E10.5 protein.
          Length = 284

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
 Frame = -1

Query: 478 THTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESI---KLIKKPFSLF 344
           T T  T +TTT AP++  + + T+E+ +T    +I   +  +K FS F
Sbjct: 218 TTTTTTTTTTTEAPTMPEAVSSTTEQSTTTTAAAIIAEETKEKEFSAF 265


>U41027-7|AAP46276.1| 1465|Caenorhabditis elegans Hypothetical protein
            R08E3.1b protein.
          Length = 1465

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = -1

Query: 496  STVSVCTHTPDTQSTTTRAPSVTRSAAVTS 407
            STVSV T T    ST+T APS ++S  V++
Sbjct: 1044 STVSVITSTTMLPSTSTVAPSTSQSTIVST 1073


>U41027-6|AAC48194.5| 1512|Caenorhabditis elegans Hypothetical protein
            R08E3.1a protein.
          Length = 1512

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = -1

Query: 496  STVSVCTHTPDTQSTTTRAPSVTRSAAVTS 407
            STVSV T T    ST+T APS ++S  V++
Sbjct: 1044 STVSVITSTTMLPSTSTVAPSTSQSTIVST 1073


>Z81143-5|CAB03518.2|  370|Caenorhabditis elegans Hypothetical
           protein ZK265.7 protein.
          Length = 370

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = -1

Query: 499 RSTVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKST 392
           ++T +  T T  T +TTT  P+   + A  + +KST
Sbjct: 163 KTTTTTTTSTTSTSTTTTEKPTTATTTARVTPKKST 198


>AL031627-6|CAA20958.1|  338|Caenorhabditis elegans Hypothetical
           protein Y102A5C.15 protein.
          Length = 338

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = -1

Query: 379 SIKLIKKPFSLFSRWSGFVMNTKSFSSSSKNIEMAVDLMVMHGL 248
           S+ L+  PF L +R +G+ +    FSS S  + MAV ++ +  +
Sbjct: 68  SVTLLGIPFILATRLAGYSLGLLKFSSYSFLVTMAVSVLSLQSV 111


>AC084161-1|ABD63205.1| 1375|Caenorhabditis elegans Hypothetical
           protein Y92H12A.5 protein.
          Length = 1375

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = -1

Query: 763 RIHLRELFEGESPPMKTRPETNRALARVDTHLTHGTTII 647
           R++L ELF+G+SP  K   E  R L   + +L    T+I
Sbjct: 19  RVNLTELFDGDSP--KIWKELERTLDASEKYLNDSDTVI 55


>Z92815-4|CAB07294.2| 2175|Caenorhabditis elegans Hypothetical
           protein W01F3.3 protein.
          Length = 2175

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKST 392
           +T +  + T +  +TTT AP+ T S  VT+ E +T
Sbjct: 235 TTTTTESPTTEASTTTTEAPTTTTSEEVTTTEITT 269


>Z73098-4|CAD44145.1|  565|Caenorhabditis elegans Hypothetical
           protein T21C9.3b protein.
          Length = 565

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 488 FSLYTHTRHTVNNHKGSISDTECS 417
           F L  +T+ TV+  KG+ SDTEC+
Sbjct: 371 FPLCDYTQCTVDVQKGNYSDTECA 394


>Z73098-3|CAD44144.1|  501|Caenorhabditis elegans Hypothetical
           protein T21C9.3a protein.
          Length = 501

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 488 FSLYTHTRHTVNNHKGSISDTECS 417
           F L  +T+ TV+  KG+ SDTEC+
Sbjct: 371 FPLCDYTQCTVDVQKGNYSDTECA 394


>AF040652-7|AAB95017.1|  210|Caenorhabditis elegans Hypothetical
           protein T05A8.6 protein.
          Length = 210

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKP 356
           +T    T T  T  TTT+AP  T + A T+ +   C   S  ++  P
Sbjct: 74  TTPGATTVTTTTAPTTTKAPDCTTTTAPTTTKAPDCTTCSQDILTDP 120


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,621,005
Number of Sequences: 27780
Number of extensions: 402363
Number of successful extensions: 1578
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 1428
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1568
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1882685842
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -