SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation fact...   169   2e-42
U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation fact...   169   2e-42
U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation fact...   166   1e-41
U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation fact...   142   3e-34
U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation fact...   138   2e-33
Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical pr...   116   2e-26
Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical pr...   116   2e-26
Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical pr...   103   1e-22
U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation f...    71   5e-13
AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial...    71   5e-13
D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation fact...    69   3e-12
D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation fact...    69   3e-12
AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongatio...    69   3e-12
Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical p...    38   0.006
L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical pr...    38   0.008
AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical ...    34   0.076
Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical pr...    33   0.17 
Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical pr...    33   0.23 
Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical pr...    33   0.23 
M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation fact...    33   0.23 
U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation fact...    32   0.40 
M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.        32   0.40 
L40996-1|AAA86431.1|  593|Caenorhabditis elegans GTP-binding pro...    31   0.70 
AF125969-2|AAD14761.1|  613|Caenorhabditis elegans Caenorhabditi...    31   0.70 
AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical ...    31   0.93 
DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic tr...    30   1.6  
AC024817-55|AAF59563.3|  366|Caenorhabditis elegans Hypothetical...    30   1.6  
Z83235-9|CAI79209.1|  705|Caenorhabditis elegans Hypothetical pr...    29   2.1  
Z83235-8|CAB05774.2|  894|Caenorhabditis elegans Hypothetical pr...    29   2.1  
AL008869-2|CAC42315.1|  810|Caenorhabditis elegans Hypothetical ...    29   2.1  
AL008869-1|CAA15516.1|  808|Caenorhabditis elegans Hypothetical ...    29   2.1  
AB032749-1|BAA92158.1|  810|Caenorhabditis elegans EAT-20B protein.    29   2.1  
AB032748-1|BAA92157.1|  808|Caenorhabditis elegans EAT-20A protein.    29   2.1  
Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical pr...    29   3.8  
AF039045-9|AAB94200.1|  315|Caenorhabditis elegans Hypothetical ...    28   5.0  
Z75710-2|CAB00025.2|  381|Caenorhabditis elegans Hypothetical pr...    28   6.6  
AF040643-5|AAT81201.1|  299|Caenorhabditis elegans Hypothetical ...    28   6.6  
Z47808-7|CAA87771.2|  934|Caenorhabditis elegans Hypothetical pr...    27   8.7  

>U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation factor
           protein 4, isoforma protein.
          Length = 463

 Score =  169 bits (410), Expect = 2e-42
 Identities = 84/119 (70%), Positives = 95/119 (79%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQTREHALLA TLGVKQLIV   K
Sbjct: 96  RDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNK 154



 Score =  142 bits (343), Expect = 3e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPP+SE RF EI  EVS +IKKIGYNP AV FVPISG++G
Sbjct: 157 STEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNG 198


>U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation factor
           protein 3 protein.
          Length = 463

 Score =  169 bits (410), Expect = 2e-42
 Identities = 84/119 (70%), Positives = 95/119 (79%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQTREHALLA TLGVKQLIV   K
Sbjct: 96  RDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNK 154



 Score =  142 bits (343), Expect = 3e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPP+SE RF EI  EVS +IKKIGYNP AV FVPISG++G
Sbjct: 157 STEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNG 198


>U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation factor
           protein 4, isoformc protein.
          Length = 267

 Score =  166 bits (404), Expect = 1e-41
 Identities = 81/114 (71%), Positives = 93/114 (81%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           RDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQTREHALLA TLGVKQL+
Sbjct: 96  RDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLV 149



 Score =  142 bits (343), Expect = 3e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66


>U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation factor
           protein 4, isoformd protein.
          Length = 429

 Score =  142 bits (343), Expect = 3e-34
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score =  108 bits (259), Expect = 4e-24
 Identities = 52/82 (63%), Positives = 63/82 (76%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E +E G G+     +    + + K   ERGITIDIALWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAQEMGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVA 405
           RDFIKNMITGTSQADCAVL+VA
Sbjct: 96  RDFIKNMITGTSQADCAVLVVA 117



 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEPP+SE RF EI  EVS +IKKIGYNP AV FVPISG++G
Sbjct: 123 STEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNG 164


>U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation factor
           protein 4, isoformb protein.
          Length = 77

 Score =  138 bits (335), Expect = 2e-33
 Identities = 64/68 (94%), Positives = 64/68 (94%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 236 DKLKAELS 259
           DKLK   S
Sbjct: 61  DKLKVTKS 68


>Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical
           protein K07A12.4b protein.
          Length = 592

 Score =  116 bits (278), Expect = 2e-26
 Identities = 55/95 (57%), Positives = 68/95 (71%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + +T+   ERG+T+DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A 
Sbjct: 223 LDETEEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNAT 282

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           TGEFE G    GQT+EHALL  +LGV QLIV   K
Sbjct: 283 TGEFETGFENGGQTKEHALLLRSLGVTQLIVAVNK 317



 Score = 79.0 bits (186), Expect = 3e-15
 Identities = 34/63 (53%), Positives = 46/63 (73%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 167 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 226

Query: 245 KAE 253
           + E
Sbjct: 227 EEE 229



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYI-KKIGYNPAAVAFVPISGWHG 646
           +S+ RF+EIK  +S ++ ++ G++     FVP+SG+ G
Sbjct: 323 WSQDRFDEIKNNLSVFLTRQAGFSKP--KFVPVSGFTG 358


>Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical
           protein K07A12.4a protein.
          Length = 610

 Score =  116 bits (278), Expect = 2e-26
 Identities = 55/95 (57%), Positives = 68/95 (71%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + +T+   ERG+T+DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A 
Sbjct: 241 LDETEEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNAT 300

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           TGEFE G    GQT+EHALL  +LGV QLIV   K
Sbjct: 301 TGEFETGFENGGQTKEHALLLRSLGVTQLIVAVNK 335



 Score = 79.0 bits (186), Expect = 3e-15
 Identities = 34/63 (53%), Positives = 46/63 (73%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 185 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 244

Query: 245 KAE 253
           + E
Sbjct: 245 EEE 247



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYI-KKIGYNPAAVAFVPISGWHG 646
           +S+ RF+EIK  +S ++ ++ G++     FVP+SG+ G
Sbjct: 341 WSQDRFDEIKNNLSVFLTRQAGFSKP--KFVPVSGFTG 376


>Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical
           protein H19N07.1 protein.
          Length = 532

 Score =  103 bits (247), Expect = 1e-22
 Identities = 50/115 (43%), Positives = 72/115 (62%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + Y RE +E G  +    L  C+     +   E+G T+++    FET K + TI+DAPGH
Sbjct: 142 EKYEREAKEKGRESW--YLSWCMDTNDEE--REKGKTVEVGRAYFETEKRHFTILDAPGH 197

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 504
           + F+ NMI G +QAD AVL+++A  GEFE G  + GQTREH++L  T GVK L++
Sbjct: 198 KSFVPNMIVGANQADLAVLVISARRGEFETGFDRGGQTREHSMLVKTAGVKHLVI 252



 Score = 75.4 bits (177), Expect = 3e-14
 Identities = 31/60 (51%), Positives = 45/60 (75%)
 Frame = +2

Query: 59  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           G  K HIN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E G+ S+  +W +D
Sbjct: 104 GTHKEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMD 163



 Score = 36.3 bits (80), Expect = 0.019
 Identities = 14/38 (36%), Positives = 27/38 (71%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           + E RF+EI+ +++ +++K+G+NP   + +VP SG  G
Sbjct: 264 WEEERFKEIEGKLTPFLRKLGFNPKTDITYVPCSGLTG 301


>U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 2 protein.
          Length = 439

 Score = 71.3 bits (167), Expect = 5e-13
 Identities = 39/83 (46%), Positives = 52/83 (62%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITI++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E   
Sbjct: 91  KRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME--- 147

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QT+EH +LA  +GVK + +
Sbjct: 148 ----QTKEHLILAKQVGVKNMAI 166



 Score = 28.7 bits (61), Expect = 3.8
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTT 127
           K ++N+  IGH+D GK+T T
Sbjct: 43  KINVNVGTIGHIDHGKTTLT 62


>AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial
           elongation factorTu homologue protein.
          Length = 439

 Score = 71.3 bits (167), Expect = 5e-13
 Identities = 39/83 (46%), Positives = 52/83 (62%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITI++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E   
Sbjct: 91  KRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME--- 147

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QT+EH +LA  +GVK + +
Sbjct: 148 ----QTKEHLILAKQVGVKNMAI 166



 Score = 28.7 bits (61), Expect = 3.8
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTT 127
           K ++N+  IGH+D GK+T T
Sbjct: 43  KINVNVGTIGHIDHGKTTLT 62


>D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 495

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 38/77 (49%), Positives = 49/77 (63%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+    ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G       
Sbjct: 96  RGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP---- 151

Query: 439 KNGQTREHALLAFTLGV 489
              QTREH LLA  +GV
Sbjct: 152 ---QTREHLLLARQVGV 165



 Score = 35.1 bits (77), Expect = 0.043
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G
Sbjct: 45  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARG 97


>D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 496

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 38/77 (49%), Positives = 49/77 (63%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+    ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G       
Sbjct: 97  RGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP---- 152

Query: 439 KNGQTREHALLAFTLGV 489
              QTREH LLA  +GV
Sbjct: 153 ---QTREHLLLARQVGV 166



 Score = 35.1 bits (77), Expect = 0.043
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARG 98


>AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 1 protein.
          Length = 496

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 38/77 (49%), Positives = 49/77 (63%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+    ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G       
Sbjct: 97  RGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP---- 152

Query: 439 KNGQTREHALLAFTLGV 489
              QTREH LLA  +GV
Sbjct: 153 ---QTREHLLLARQVGV 166



 Score = 35.1 bits (77), Expect = 0.043
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARG 98


>Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical
           protein F46B6.6a protein.
          Length = 702

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +1

Query: 262 GITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  I  +  E +K   VT +D PGH  F      G   AD  VL+VAA  G
Sbjct: 188 GITQHIGAFSVELTKGRRVTFLDTPGHAAFASMRARGAKGADIVVLVVAADDG 240


>L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical
           protein ZK1236.1 protein.
          Length = 645

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 19/54 (35%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGIT+           Y + +ID PGH DF   +    +  D  +L+VAA  G
Sbjct: 85  ERGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQG 138



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 3/42 (7%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI---DKRTIEKFEKEAQ 196
           N  ++ HVD GKST    L+  CG +    K+ ++K + E +
Sbjct: 44  NFGIVAHVDHGKSTLADRLLEMCGAVPPGQKQMLDKLQVERE 85


>AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical
           protein Y119D3B.14 protein.
          Length = 689

 Score = 34.3 bits (75), Expect = 0.076
 Identities = 15/26 (57%), Positives = 18/26 (69%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI 157
           NI VI HVD+GK+T T  L+Y  G I
Sbjct: 27  NIGVIAHVDAGKTTVTERLLYLAGAI 52



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGIT+  A    +   + + +ID PGH DF   +       D  V+++    G
Sbjct: 73  ERGITVQSAAVNLDWKGHRINLIDTPGHVDFRVEVERCVRVLDGIVVVIDGSAG 126


>Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical
           protein F29C12.4 protein.
          Length = 750

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGID 160
           NI +  H+DSGK+T T  ++Y  G ID
Sbjct: 46  NIGISAHIDSGKTTVTERILYYAGRID 72



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A    +     + IID PGH DF   +       D AVL++  G G
Sbjct: 95  QRGITIQSAATYVDWHGTNINIIDTPGHVDFTVEVERALRVLDGAVLVL-CGVG 147


>Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical
           protein C47B2.7b protein.
          Length = 500

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           + +ID PGH   I+ ++  ++  D A++I+     +  AGI    QT EH LLA      
Sbjct: 74  LALIDCPGHSGLIRAVLAASTVFDMAIVII-----DVVAGIQP--QTAEHLLLASKFCPN 126

Query: 493 QLIV 504
           ++I+
Sbjct: 127 RVII 130



 Score = 28.7 bits (61), Expect = 3.8
 Identities = 10/17 (58%), Positives = 15/17 (88%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTT 127
           +N+ ++GHVDSGK+T T
Sbjct: 14  LNLGILGHVDSGKTTLT 30


>Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical
           protein F25H5.4 protein.
          Length = 852

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M +++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 13/50 (26%), Positives = 27/50 (54%)
 Frame = +1

Query: 268 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           T+++   K + + + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 97  TVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 146


>M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation factor
           protein.
          Length = 852

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M +++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 13/50 (26%), Positives = 27/50 (54%)
 Frame = +1

Query: 268 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           T+++   K + + + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 97  TVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALGVTDGALVVVDCVSG 146


>U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation factor
           protein 1 protein.
          Length = 974

 Score = 31.9 bits (69), Expect = 0.40
 Identities = 19/64 (29%), Positives = 29/64 (45%)
 Frame = +1

Query: 226 LGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 405
           L I + +G + +   + I      +  Y + IID PGH +F   M      AD  V++V 
Sbjct: 174 LFIEKQRGCSIKSQPVSIVAQDSRSKSYLLNIIDTPGHVNFSDEMTASYRLADGVVVMVD 233

Query: 406 AGTG 417
           A  G
Sbjct: 234 AHEG 237


>M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.
          Length = 849

 Score = 31.9 bits (69), Expect = 0.40
 Identities = 19/64 (29%), Positives = 29/64 (45%)
 Frame = +1

Query: 226 LGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 405
           L I + +G + +   + I      +  Y + IID PGH +F   M      AD  V++V 
Sbjct: 49  LFIEKQRGCSIKSQPVSIVAQDSRSKSYLLNIIDTPGHVNFSDEMTASYRLADGVVVMVD 108

Query: 406 AGTG 417
           A  G
Sbjct: 109 AHEG 112


>L40996-1|AAA86431.1|  593|Caenorhabditis elegans GTP-binding
           protein protein.
          Length = 593

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 32  FVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIY 142
           ++IRD P   K+     + V+G+VD+GKST  G L +
Sbjct: 127 WIIRD-PPTEKDFIEARVAVVGNVDAGKSTLLGVLTH 162


>AF125969-2|AAD14761.1|  613|Caenorhabditis elegans Caenorhabditis
           gtp-binding proteinprotein 1 protein.
          Length = 613

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 32  FVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIY 142
           ++IRD P   K+     + V+G+VD+GKST  G L +
Sbjct: 127 WIIRD-PPTEKDFIEARVAVVGNVDAGKSTLLGVLTH 162


>AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical
           protein Y39G10AR.8 protein.
          Length = 469

 Score = 30.7 bits (66), Expect = 0.93
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 405
           +V+ +D PGH   +  M+ G +  D A L+VA
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAAFLLVA 159


>DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic
           translation initiationfactor eIF5B protein.
          Length = 1074

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           IID PGH  F      G+S  D A+L+V
Sbjct: 553 IIDTPGHESFSNLRTRGSSLCDFAILVV 580


>AC024817-55|AAF59563.3|  366|Caenorhabditis elegans Hypothetical
           protein Y54G2A.28 protein.
          Length = 366

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = -1

Query: 506 PTMSCLTPRVKASKACSRV*PFLEIPASNSPVPAATMSTA 387
           PT+SC+  +  AS   S   P +  PA N  VP AT+S +
Sbjct: 16  PTLSCMATQNSASATLSCANPTVAAPA-NDDVPEATLSVS 54


>Z83235-9|CAI79209.1|  705|Caenorhabditis elegans Hypothetical
           protein K10C3.5b protein.
          Length = 705

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           RGIT+  +          + +ID+PGH DF   + +    +D A+L++
Sbjct: 67  RGITMKSSGISLLCEPLLINLIDSPGHVDFSGEVTSALILSDIALLLI 114


>Z83235-8|CAB05774.2|  894|Caenorhabditis elegans Hypothetical
           protein K10C3.5a protein.
          Length = 894

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           RGIT+  +          + +ID+PGH DF   + +    +D A+L++
Sbjct: 67  RGITMKSSGISLLCEPLLINLIDSPGHVDFSGEVTSALILSDIALLLI 114


>AL008869-2|CAC42315.1|  810|Caenorhabditis elegans Hypothetical
           protein H30A04.1b protein.
          Length = 810

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 576 PHTSRRLATTQLLSLSCPFLD 638
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AL008869-1|CAA15516.1|  808|Caenorhabditis elegans Hypothetical
           protein H30A04.1a protein.
          Length = 808

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 576 PHTSRRLATTQLLSLSCPFLD 638
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AB032749-1|BAA92158.1|  810|Caenorhabditis elegans EAT-20B protein.
          Length = 810

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 576 PHTSRRLATTQLLSLSCPFLD 638
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AB032748-1|BAA92157.1|  808|Caenorhabditis elegans EAT-20A protein.
          Length = 808

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 576 PHTSRRLATTQLLSLSCPFLD 638
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical
           protein C47B2.7a protein.
          Length = 459

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 10/17 (58%), Positives = 15/17 (88%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTT 127
           +N+ ++GHVDSGK+T T
Sbjct: 14  LNLGILGHVDSGKTTLT 30


>AF039045-9|AAB94200.1|  315|Caenorhabditis elegans Hypothetical
           protein F15E11.3 protein.
          Length = 315

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 209 GSFKYAWVLDKLKAELSVVSQSILLSGSSKL 301
           GS KY WVLDK  + + V +   L++ S  L
Sbjct: 218 GSLKYIWVLDKTTSAILVENNPNLIAKSKAL 248


>Z75710-2|CAB00025.2|  381|Caenorhabditis elegans Hypothetical
           protein D1081.4 protein.
          Length = 381

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 2/34 (5%)
 Frame = +1

Query: 313 VTIIDAPGHRDFI--KNMITGTSQADCAVLIVAA 408
           V IID+ G RDFI  KN+  GT  AD  +++ AA
Sbjct: 73  VQIIDSSGSRDFIGMKNLYIGT--ADAFLVVFAA 104


>AF040643-5|AAT81201.1|  299|Caenorhabditis elegans Hypothetical
           protein F14D2.15 protein.
          Length = 299

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 10/92 (10%)
 Frame = -3

Query: 498 ELFDTEGESEQGMLTGLTVLRDTSFEF-----TGTGSYDEHSAISLRGSCDH--VLDEIS 340
           E + +E E   G+   L V RD  F +     +GTGS + H   ++R   DH  + +   
Sbjct: 24  EHYTSEEEDHFGIKWWLRVTRDDQFLYVDLGKSGTGSTNFHGNFNVRVESDHGVISENFK 83

Query: 339 VSRSINDGNIVLASFELPE---SNIDCDTTLS 253
            S S +D  I   S        SN+D    LS
Sbjct: 84  FSGSKSDAEIPSTSNRCESFKWSNLDYSKYLS 115


>Z47808-7|CAA87771.2|  934|Caenorhabditis elegans Hypothetical
           protein D2013.5 protein.
          Length = 934

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +2

Query: 173 EKFEKEAQEMGKGSFKYAWVLDKLKAELSVVSQSILLS 286
           E+ +K  +EM K   +Y   L++L+ E  V+ Q +LLS
Sbjct: 211 ERIQKLQEEMLKTQSQYQRELERLEKENKVLKQRLLLS 248


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,027,311
Number of Sequences: 27780
Number of extensions: 308173
Number of successful extensions: 982
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 899
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 977
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1434198608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -