SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93256-1|AAB59181.1| 1110|Caenorhabditis elegans tra-1 protein.        30   1.2  
AL117202-5|CAB61040.2| 1109|Caenorhabditis elegans Hypothetical ...    30   1.2  
Z49130-8|CAA88973.1| 1490|Caenorhabditis elegans Hypothetical pr...    29   2.8  
Z49129-3|CAA88963.1| 1490|Caenorhabditis elegans Hypothetical pr...    29   2.8  
U29614-4|ABD94109.1|  244|Caenorhabditis elegans Hypothetical pr...    29   3.7  

>M93256-1|AAB59181.1| 1110|Caenorhabditis elegans tra-1 protein.
          Length = 1110

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +3

Query: 330  LVRAQEEYLDRRRTRSLNAPSPIQQFGPCGRIMK--NSAMVMQIQDPASQRLTWY 488
            ++RAQE+  + R   SL+ P+P    G  G I    NSA+ +Q + P S   +W+
Sbjct: 1015 IMRAQEDS-NNRILLSLDIPAPSAVTGVSGSITHADNSALQLQQEQPTSSFSSWF 1068


>AL117202-5|CAB61040.2| 1109|Caenorhabditis elegans Hypothetical
            protein Y47D3A.6a protein.
          Length = 1109

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +3

Query: 330  LVRAQEEYLDRRRTRSLNAPSPIQQFGPCGRIMK--NSAMVMQIQDPASQRLTWY 488
            ++RAQE+  + R   SL+ P+P    G  G I    NSA+ +Q + P S   +W+
Sbjct: 1014 IMRAQEDS-NNRILLSLDIPAPSAVTGVSGSITHADNSALQLQQEQPTSSFSSWF 1067


>Z49130-8|CAA88973.1| 1490|Caenorhabditis elegans Hypothetical
           protein T06D8.10 protein.
          Length = 1490

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -3

Query: 575 ERASVLAERRVPVSGRREPS**QHGEGRLVPGQPL 471
           E+   LA+R +    RRE S  +H +GR V G PL
Sbjct: 719 EKVISLAKRNLKDQERREISNLKHNQGRFVKGDPL 753


>Z49129-3|CAA88963.1| 1490|Caenorhabditis elegans Hypothetical
           protein T06D8.10 protein.
          Length = 1490

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -3

Query: 575 ERASVLAERRVPVSGRREPS**QHGEGRLVPGQPL 471
           E+   LA+R +    RRE S  +H +GR V G PL
Sbjct: 719 EKVISLAKRNLKDQERREISNLKHNQGRFVKGDPL 753


>U29614-4|ABD94109.1|  244|Caenorhabditis elegans Hypothetical
           protein F18E9.8 protein.
          Length = 244

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = -1

Query: 463 GSWICMTMAEFFIILPHGPNCCIGDGAF 380
           G+WIC ++   +++L    +CCIG G+F
Sbjct: 117 GAWICESIKYLWVVLYDVVSCCIG-GSF 143


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,183,914
Number of Sequences: 27780
Number of extensions: 359218
Number of successful extensions: 911
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 876
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 911
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1423653030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -