SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U56963-7|AAQ01523.1|  526|Caenorhabditis elegans Amino acid tran...    30   2.1  
Z75536-4|CAA99832.3| 2271|Caenorhabditis elegans Hypothetical pr...    28   6.4  
Z75536-3|CAA99831.3| 2279|Caenorhabditis elegans Hypothetical pr...    28   6.4  
AL117201-2|CAI79268.1|  527|Caenorhabditis elegans Hypothetical ...    28   6.4  
AL117201-1|CAB55063.1|  541|Caenorhabditis elegans Hypothetical ...    28   6.4  
AF372457-1|AAK54248.1| 2279|Caenorhabditis elegans endocytosis p...    28   6.4  
AF100656-9|AAF99966.1|  215|Caenorhabditis elegans Hypothetical ...    28   6.4  
Z83230-1|CAB05741.1| 1049|Caenorhabditis elegans Hypothetical pr...    28   8.5  
Z75714-2|CAB00059.1|  474|Caenorhabditis elegans Hypothetical pr...    28   8.5  

>U56963-7|AAQ01523.1|  526|Caenorhabditis elegans Amino acid
           transporter protein 4 protein.
          Length = 526

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 15/54 (27%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = -3

Query: 619 TSSVLQF-NFIVI*RRIFLIDPLL*IFYHDVVVYALSFKTRVIFSTTFGLIRMS 461
           T+S++ + +F++  +R+F +  L+ I Y ++ V+  + +  +IFS  F LI ++
Sbjct: 366 TNSLINYVSFVMFGQRVFTMTALMWIRYRNIPVHPDAIRVPLIFSFLFWLITIA 419


>Z75536-4|CAA99832.3| 2271|Caenorhabditis elegans Hypothetical protein
            F18C12.2b protein.
          Length = 2271

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = +2

Query: 2    GTRAERRRFVEAPRTSSAVKTELY 73
            GTRAE   FVE  RTS+   +ELY
Sbjct: 1665 GTRAEVLEFVERHRTSNEPTSELY 1688


>Z75536-3|CAA99831.3| 2279|Caenorhabditis elegans Hypothetical protein
            F18C12.2a protein.
          Length = 2279

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = +2

Query: 2    GTRAERRRFVEAPRTSSAVKTELY 73
            GTRAE   FVE  RTS+   +ELY
Sbjct: 1665 GTRAEVLEFVERHRTSNEPTSELY 1688


>AL117201-2|CAI79268.1|  527|Caenorhabditis elegans Hypothetical
           protein Y53H1C.1b protein.
          Length = 527

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = -3

Query: 619 TSSVLQF-NFIVI*RRIFLIDPLL*IFYHDVVVYALSFKTRVIFSTTFGLIRMS 461
           T S++ +  F++  +R+F +  LL I Y ++ V+  + +  +IFS  F +I ++
Sbjct: 369 TESLITYVTFVMFGQRVFTMAALLWIRYRNIPVHPDAIRVPLIFSILFFMITIA 422


>AL117201-1|CAB55063.1|  541|Caenorhabditis elegans Hypothetical
           protein Y53H1C.1a protein.
          Length = 541

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = -3

Query: 619 TSSVLQF-NFIVI*RRIFLIDPLL*IFYHDVVVYALSFKTRVIFSTTFGLIRMS 461
           T S++ +  F++  +R+F +  LL I Y ++ V+  + +  +IFS  F +I ++
Sbjct: 369 TESLITYVTFVMFGQRVFTMAALLWIRYRNIPVHPDAIRVPLIFSILFFMITIA 422


>AF372457-1|AAK54248.1| 2279|Caenorhabditis elegans endocytosis
            protein RME-8 protein.
          Length = 2279

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = +2

Query: 2    GTRAERRRFVEAPRTSSAVKTELY 73
            GTRAE   FVE  RTS+   +ELY
Sbjct: 1665 GTRAEVLEFVERHRTSNEPTSELY 1688


>AF100656-9|AAF99966.1|  215|Caenorhabditis elegans Hypothetical
          protein F49F1.10 protein.
          Length = 215

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 11/19 (57%), Positives = 12/19 (63%)
 Frame = +3

Query: 9  GLRGGGSSKPPEPALQSKP 65
          G RGGG  +PP P   SKP
Sbjct: 42 GRRGGGRHRPPRPPRPSKP 60


>Z83230-1|CAB05741.1| 1049|Caenorhabditis elegans Hypothetical
           protein F56A8.1 protein.
          Length = 1049

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 10/34 (29%), Positives = 19/34 (55%)
 Frame = +2

Query: 593 EIELQDRRGHRMTWKQYHRLEDIYGFMDYLAKPI 694
           EIEL  RR   + W+++++ + +    DY  + I
Sbjct: 230 EIELDPRRSLSLNWERWYKFQPLNKIRDYFGEQI 263


>Z75714-2|CAB00059.1|  474|Caenorhabditis elegans Hypothetical
           protein ZC434.3 protein.
          Length = 474

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 5/44 (11%)
 Frame = -3

Query: 124 PPRTTRPFASWIPWLLNVKFGFDCRAGS-----GGFDEPPPLSP 8
           P R   P  +  P++ N+ FG D   G      GGFD P PL+P
Sbjct: 166 PVRCRPPMCN--PFVHNMAFGVDVEPGDDYLFDGGFDFPIPLAP 207


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,662,874
Number of Sequences: 27780
Number of extensions: 327286
Number of successful extensions: 852
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 838
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 852
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1851132448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -