SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z73899-9|CAA98072.2|  905|Caenorhabditis elegans Hypothetical pr...    31   0.96 
Z11576-1|CAA77663.1|  625|Caenorhabditis elegans aromatic-L-amin...    31   0.96 
U64854-6|AAB18318.2| 5079|Caenorhabditis elegans Uncoordinated p...    29   3.9  
D45899-1|BAA08309.1| 5071|Caenorhabditis elegans ryanodine recep...    29   3.9  
Z68880-4|CAA93093.1|  544|Caenorhabditis elegans Hypothetical pr...    28   5.1  
Z99268-1|CAB16466.1|  715|Caenorhabditis elegans Hypothetical pr...    27   8.9  
Z81573-4|CAB04627.1|  715|Caenorhabditis elegans Hypothetical pr...    27   8.9  
Z49908-10|CAA90103.1|  715|Caenorhabditis elegans Hypothetical p...    27   8.9  
EU068465-1|ABU49430.1|  715|Caenorhabditis elegans PRO-2 protein.      27   8.9  

>Z73899-9|CAA98072.2|  905|Caenorhabditis elegans Hypothetical protein
            ZK829.2 protein.
          Length = 905

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +2

Query: 413  PLDSCSACCPHRKWLHASIHSADRYKRNNAKIIASKGKLP---PPSNAASTPNTAIA 574
            PL+ C +       +H + ++    K N +  +A+KG+LP   PPS  + TPN+ I+
Sbjct: 846  PLEPCRSLAQISSQMHTAEYADPPGKSNKSPQVAAKGELPSAAPPS--SRTPNSDIS 900


>Z11576-1|CAA77663.1|  625|Caenorhabditis elegans aromatic-L-amino
           acid  decarboxylaseprotein.
          Length = 625

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +2

Query: 413 PLDSCSACCPHRKWLHASIHSADRYKRNNAKIIASKGKLP---PPSNAASTPNTAIA 574
           PL+ C +       +H + ++    K N +  +A+KG+LP   PPS  + TPN+ I+
Sbjct: 566 PLEPCRSLAQISSQMHTAEYADPPGKSNKSPQVAAKGELPSAAPPS--SRTPNSDIS 620


>U64854-6|AAB18318.2| 5079|Caenorhabditis elegans Uncoordinated
            protein 68 protein.
          Length = 5079

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 18/73 (24%), Positives = 35/73 (47%)
 Frame = -1

Query: 314  NVDRRFGHKPVDSEVTFFKFLSLSVTSMISLWILDSGSSFKSESPMVKLVTQSDIRMGRK 135
            +V++RF +  ++  +T+ +  SL + S+     L   +SFK E   VK   +  + +   
Sbjct: 3048 SVEKRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHA 3107

Query: 134  LIIAHKCFTVSTS 96
               AHK + +  S
Sbjct: 3108 YFNAHKNYFLEGS 3120


>D45899-1|BAA08309.1| 5071|Caenorhabditis elegans ryanodine receptor
            protein.
          Length = 5071

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 18/73 (24%), Positives = 35/73 (47%)
 Frame = -1

Query: 314  NVDRRFGHKPVDSEVTFFKFLSLSVTSMISLWILDSGSSFKSESPMVKLVTQSDIRMGRK 135
            +V++RF +  ++  +T+ +  SL + S+     L   +SFK E   VK   +  + +   
Sbjct: 3053 SVEKRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHA 3112

Query: 134  LIIAHKCFTVSTS 96
               AHK + +  S
Sbjct: 3113 YFNAHKNYFLEGS 3125


>Z68880-4|CAA93093.1|  544|Caenorhabditis elegans Hypothetical
           protein T14G10.7 protein.
          Length = 544

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 246 EGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVSTSH 395
           + +E ++   RV  L+SE+ IDV H N  +  D  +K+      A+  SH
Sbjct: 190 KSEEKQKASTRVTDLVSETLIDVPHLNSIVRRDLRQKMQPWQIAALPLSH 239


>Z99268-1|CAB16466.1|  715|Caenorhabditis elegans Hypothetical
           protein C07E3.2 protein.
          Length = 715

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/66 (24%), Positives = 28/66 (42%)
 Frame = +1

Query: 118 LCAIISFLPIRISDCVTSFTMGDSLLKEDPLSRIQREIIEVTERERNLKKVTSESTGLCP 297
           LC   +FLP+R+  C     +  S     P+ ++  + +E   RE   K    +     P
Sbjct: 449 LCNAPTFLPLRLHCCQLLIQLQASCTNYIPILQVSCDCLEELARELKSKPKPVKGAVKLP 508

Query: 298 NLRSTL 315
           ++  TL
Sbjct: 509 DIECTL 514


>Z81573-4|CAB04627.1|  715|Caenorhabditis elegans Hypothetical
           protein C07E3.2 protein.
          Length = 715

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/66 (24%), Positives = 28/66 (42%)
 Frame = +1

Query: 118 LCAIISFLPIRISDCVTSFTMGDSLLKEDPLSRIQREIIEVTERERNLKKVTSESTGLCP 297
           LC   +FLP+R+  C     +  S     P+ ++  + +E   RE   K    +     P
Sbjct: 449 LCNAPTFLPLRLHCCQLLIQLQASCTNYIPILQVSCDCLEELARELKSKPKPVKGAVKLP 508

Query: 298 NLRSTL 315
           ++  TL
Sbjct: 509 DIECTL 514


>Z49908-10|CAA90103.1|  715|Caenorhabditis elegans Hypothetical
           protein C07E3.2 protein.
          Length = 715

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/66 (24%), Positives = 28/66 (42%)
 Frame = +1

Query: 118 LCAIISFLPIRISDCVTSFTMGDSLLKEDPLSRIQREIIEVTERERNLKKVTSESTGLCP 297
           LC   +FLP+R+  C     +  S     P+ ++  + +E   RE   K    +     P
Sbjct: 449 LCNAPTFLPLRLHCCQLLIQLQASCTNYIPILQVSCDCLEELARELKSKPKPVKGAVKLP 508

Query: 298 NLRSTL 315
           ++  TL
Sbjct: 509 DIECTL 514


>EU068465-1|ABU49430.1|  715|Caenorhabditis elegans PRO-2 protein.
          Length = 715

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/66 (24%), Positives = 28/66 (42%)
 Frame = +1

Query: 118 LCAIISFLPIRISDCVTSFTMGDSLLKEDPLSRIQREIIEVTERERNLKKVTSESTGLCP 297
           LC   +FLP+R+  C     +  S     P+ ++  + +E   RE   K    +     P
Sbjct: 449 LCNAPTFLPLRLHCCQLLIQLQASCTNYIPILQVSCDCLEELARELKSKPKPVKGAVKLP 508

Query: 298 NLRSTL 315
           ++  TL
Sbjct: 509 DIECTL 514


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,392,316
Number of Sequences: 27780
Number of extensions: 293998
Number of successful extensions: 963
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 961
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1476380920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -