SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20045
         (722 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z78019-2|CAB01451.1|  347|Caenorhabditis elegans Hypothetical pr...    28   5.9  
U64844-10|AAB18310.1|  448|Caenorhabditis elegans Hypothetical p...    28   7.8  
AL023856-4|CAC15863.1|  331|Caenorhabditis elegans Hypothetical ...    28   7.8  

>Z78019-2|CAB01451.1|  347|Caenorhabditis elegans Hypothetical
           protein ZK863.5 protein.
          Length = 347

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%)
 Frame = -1

Query: 530 LVEKMSRWQC-LSFSLVIHFYYYS 462
           L + +S W C L FSL +HF+ YS
Sbjct: 78  LCKYLSEWSCFLGFSLQLHFHSYS 101


>U64844-10|AAB18310.1|  448|Caenorhabditis elegans Hypothetical
           protein T22F3.7 protein.
          Length = 448

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 16/47 (34%), Positives = 29/47 (61%)
 Frame = -3

Query: 216 ATRIQVHLHELLQNRLPDHDRPLGRSLTVPDYMPLRFCLALISDRIR 76
           +T I ++LHE+L+  + +       SL +   +P+RF  ALISD+++
Sbjct: 297 STYIPLYLHEVLKFGVTETG--FYASLILGISLPVRFVFALISDKLK 341


>AL023856-4|CAC15863.1|  331|Caenorhabditis elegans Hypothetical
           protein Y94A7B.7 protein.
          Length = 331

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 577 YCGGFYHILPRTIRLWNELPFTVFSERYDMSFFKRGLWRYL 699
           Y    + I+P TI        ++F  RY + F K+G WRYL
Sbjct: 98  YVLAIFKIVPMTI-------ISMFENRYFVLFVKKGPWRYL 131


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,475,749
Number of Sequences: 27780
Number of extensions: 388403
Number of successful extensions: 1018
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 880
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1018
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1697838058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -