SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20041
         (743 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z93386-5|CAB07646.1|  473|Caenorhabditis elegans Hypothetical pr...   105   3e-23
AC024859-4|AAK29983.4|  472|Caenorhabditis elegans Hypothetical ...    91   1e-18
Z92829-11|CAE17737.1|  257|Caenorhabditis elegans Hypothetical p...    33   0.28 
Z68214-4|CAA92447.1|  397|Caenorhabditis elegans Hypothetical pr...    30   1.5  
Z68214-5|CAA92446.2|  397|Caenorhabditis elegans Hypothetical pr...    29   3.5  
Z68214-3|CAA92445.1|  399|Caenorhabditis elegans Hypothetical pr...    29   3.5  
Z11795-1|CAA77838.1|  130|Caenorhabditis elegans pceh16-1 protei...    29   3.5  
Z66521-11|CAA91398.2|  471|Caenorhabditis elegans Hypothetical p...    29   4.6  
AB031233-1|BAA92262.1|  605|Caenorhabditis elegans kinesin like ...    29   4.6  
Z81055-2|CAB02891.2|  437|Caenorhabditis elegans Hypothetical pr...    28   8.0  
Z54306-6|CAA91090.2|  321|Caenorhabditis elegans Hypothetical pr...    28   8.0  
X69016-1|CAA48781.1|  549|Caenorhabditis elegans ced-4 protein.        28   8.0  
U21324-2|AAX22294.1|  571|Caenorhabditis elegans Cell death abno...    28   8.0  
U21324-1|AAA62564.1|  549|Caenorhabditis elegans Cell death abno...    28   8.0  
AL031268-1|CAD59161.1|  321|Caenorhabditis elegans Hypothetical ...    28   8.0  
AF067945-16|AAC17675.1|  341|Caenorhabditis elegans Serpentine r...    28   8.0  

>Z93386-5|CAB07646.1|  473|Caenorhabditis elegans Hypothetical
           protein R11H6.1 protein.
          Length = 473

 Score =  105 bits (252), Expect = 3e-23
 Identities = 46/85 (54%), Positives = 61/85 (71%)
 Frame = +3

Query: 255 DKLKEVGATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDG 434
           +KL+ +G   EL D+G Q ++GK V+          +D  K T+ +YGHLDVQPA KSDG
Sbjct: 51  EKLETIGTICELADLGTQELEGKTVKLPPVLLGTLGSDKNKKTLLVYGHLDVQPAAKSDG 110

Query: 435 WETEPFELVERNEKLYGRGSTDDKG 509
           W+TEPFELVE++ KL+GRGS+DDKG
Sbjct: 111 WDTEPFELVEKDGKLFGRGSSDDKG 135



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/46 (52%), Positives = 33/46 (71%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMVHWMQ 255
           L  +F+ +D + D+ K+LL+EAVAI SVS D   R + IRMVHWM+
Sbjct: 5   LTNVFQQIDGDYDNLKELLREAVAIQSVSGDPSKRDETIRMVHWMK 50



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 22/37 (59%), Positives = 29/37 (78%)
 Frame = +1

Query: 631 LMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           L+++ K + F   VD+VCISD+YWLGT KPC+T GLR
Sbjct: 176 LLEREK-DRFLAGVDFVCISDSYWLGTKKPCLTYGLR 211



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 23/38 (60%), Positives = 26/38 (68%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W H I A +  G +LPVN+KF  E MEESGS GL
Sbjct: 136 PVLCWFHAIRAAQKNGIDLPVNIKFCLEGMEESGSVGL 173


>AC024859-4|AAK29983.4|  472|Caenorhabditis elegans Hypothetical
           protein Y71H2AM.11 protein.
          Length = 472

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 44/86 (51%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 DKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSD 431
           D+LK +G  T L ++G QT+  G+ +            D  K T+ IYGHLDVQPA K D
Sbjct: 50  DQLKTLGVETSLWELGQQTLPSGEQLPLPPAVFGVYGRDKSKKTLLIYGHLDVQPAEKED 109

Query: 432 GWETEPFELVERNEKLYGRGSTDDKG 509
           GW T PFEL E + KL+GRGSTDDKG
Sbjct: 110 GWNTNPFELTEIDGKLFGRGSTDDKG 135



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 19/38 (50%), Positives = 27/38 (71%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PV+ W+  +   +  G +LP+N+KF+ ECMEES SEGL
Sbjct: 136 PVIAWIAVLKVLQTLGIDLPINIKFVLECMEESSSEGL 173



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 20/41 (48%), Positives = 28/41 (68%)
 Frame = +1

Query: 127 IFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMVHW 249
           +FK +D+ +D +  LL+E+VAI SVS D   R DC+RM  W
Sbjct: 7   VFKSIDERQDEFIDLLRESVAIQSVSADPARRGDCVRMSEW 47



 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +1

Query: 670 VDYVCISDNYWLGTTKPCITNGLR 741
           V + CISDNYWLG  KPC+T GLR
Sbjct: 187 VTFSCISDNYWLGRNKPCLTYGLR 210


>Z92829-11|CAE17737.1|  257|Caenorhabditis elegans Hypothetical
           protein F10A3.16 protein.
          Length = 257

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = -2

Query: 724 YMASWFPTNSYRIYIHSL-HYQRIPQVSICPLISC 623
           Y   W+  + YR Y H L ++Q IP++S C +I C
Sbjct: 132 YSVLWY--SDYRKYFHQLQNFQAIPRISFCSIIVC 164


>Z68214-4|CAA92447.1|  397|Caenorhabditis elegans Hypothetical
           protein C10C5.4 protein.
          Length = 397

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFE-LVERNEKLYGRGSTDDKGL 512
           + P+  ++ +Y H DV P  + + W  +P+    + +  ++ RG+ D K L
Sbjct: 63  SQPELPSIMLYSHTDVVPTFR-EHWTHDPYSAFKDEDGNIFARGAQDTKCL 112


>Z68214-5|CAA92446.2|  397|Caenorhabditis elegans Hypothetical
           protein C10C5.5 protein.
          Length = 397

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 12/49 (24%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFE-LVERNEKLYGRGSTDDK 506
           + P+  ++ +Y H DV P  + + W  +P+    + +  ++ RG+ D K
Sbjct: 63  SQPELPSIMLYSHTDVVPTFR-EHWTHDPYSAFKDEDGNIFARGAQDMK 110


>Z68214-3|CAA92445.1|  399|Caenorhabditis elegans Hypothetical
           protein C10C5.3 protein.
          Length = 399

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 12/49 (24%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFE-LVERNEKLYGRGSTDDK 506
           + P+  ++ +Y H DV P  + + W  +P+    + +  ++ RG+ D K
Sbjct: 63  SQPELPSIMLYSHTDVVPTFR-EHWTHDPYSAFKDEDGNIFARGAQDMK 110


>Z11795-1|CAA77838.1|  130|Caenorhabditis elegans pceh16-1 protein
           protein.
          Length = 130

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = -2

Query: 694 YRIYIHSLHYQRIPQVSICPLISCQAFGTRFLHTFENELQIDRQLSTSALI 542
           Y +Y     Y+R  + S+C     QA+  R L   E E Q D+ LS +  I
Sbjct: 7   YNMYSRKHDYKR-SRKSVCERKPRQAYSARQLDRLETEFQTDKYLSVNKRI 56


>Z66521-11|CAA91398.2|  471|Caenorhabditis elegans Hypothetical
           protein W02B12.7 protein.
          Length = 471

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 13/51 (25%), Positives = 25/51 (49%)
 Frame = +1

Query: 55  YHQHYSVSSKQVSAKMATEKTLPEIFKYVDQNKDSYKQLLKEAVAIPSVSC 207
           Y+ H +    Q++       T+P++   + + K+  K L +E+   PS SC
Sbjct: 11  YNNHTNDLKHQIAQLERKTATIPKLENQLHKAKNQNKVLRRESALFPSASC 61


>AB031233-1|BAA92262.1|  605|Caenorhabditis elegans kinesin like
           protein protein.
          Length = 605

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 13/51 (25%), Positives = 25/51 (49%)
 Frame = +1

Query: 55  YHQHYSVSSKQVSAKMATEKTLPEIFKYVDQNKDSYKQLLKEAVAIPSVSC 207
           Y+ H +    Q++       T+P++   + + K+  K L +E+   PS SC
Sbjct: 145 YNNHTNDLKHQIAQLERKTATIPKLENQLHKAKNQNKVLRRESALFPSASC 195


>Z81055-2|CAB02891.2|  437|Caenorhabditis elegans Hypothetical
           protein F01G10.2 protein.
          Length = 437

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSD-GWETEPFELVERNEKLYGRGSTDDKGLY 515
           TV     LDV   LK + GW    FE     +K YGR +  +KG Y
Sbjct: 265 TVADMNGLDVMEKLKKENGWPASDFEKEVWRQKRYGRKT--NKGYY 308


>Z54306-6|CAA91090.2|  321|Caenorhabditis elegans Hypothetical
           protein B0457.2 protein.
          Length = 321

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +3

Query: 483 GRGSTDDKGLYLVGCIPSMPIRALVLSCLSI*SSFSNV 596
           GR  +D KG++   C PS P+R  ++      ++F NV
Sbjct: 164 GRYCSDMKGMFAYTCAPSKPLRIDLVEFCKDYAAFCNV 201


>X69016-1|CAA48781.1|  549|Caenorhabditis elegans ced-4 protein.
          Length = 549

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = -2

Query: 595 TFENELQIDRQLSTSALIGIDGMQPTKYRPLS 500
           TFE   Q++ +L +  L+G++ + P  Y+ L+
Sbjct: 344 TFEKMAQLNNKLESRGLVGVECITPYSYKSLA 375


>U21324-2|AAX22294.1|  571|Caenorhabditis elegans Cell death
           abnormality protein4, isoform b protein.
          Length = 571

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = -2

Query: 595 TFENELQIDRQLSTSALIGIDGMQPTKYRPLS 500
           TFE   Q++ +L +  L+G++ + P  Y+ L+
Sbjct: 366 TFEKMAQLNNKLESRGLVGVECITPYSYKSLA 397


>U21324-1|AAA62564.1|  549|Caenorhabditis elegans Cell death
           abnormality protein4, isoform a protein.
          Length = 549

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = -2

Query: 595 TFENELQIDRQLSTSALIGIDGMQPTKYRPLS 500
           TFE   Q++ +L +  L+G++ + P  Y+ L+
Sbjct: 344 TFEKMAQLNNKLESRGLVGVECITPYSYKSLA 375


>AL031268-1|CAD59161.1|  321|Caenorhabditis elegans Hypothetical
           protein B0457.2 protein.
          Length = 321

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +3

Query: 483 GRGSTDDKGLYLVGCIPSMPIRALVLSCLSI*SSFSNV 596
           GR  +D KG++   C PS P+R  ++      ++F NV
Sbjct: 164 GRYCSDMKGMFAYTCAPSKPLRIDLVEFCKDYAAFCNV 201


>AF067945-16|AAC17675.1|  341|Caenorhabditis elegans Serpentine
           receptor, class e (epsilon)protein 12 protein.
          Length = 341

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +2

Query: 47  FLLIINIIQ*VPNKFLQKWQRKKH 118
           FL+I+N+   + N+FL+ W  KK+
Sbjct: 172 FLMILNLFALLTNQFLRTWNLKKY 195


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,253,804
Number of Sequences: 27780
Number of extensions: 396417
Number of successful extensions: 1008
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 977
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1008
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1756472266
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -