SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF106592-2|AAK21364.1|  170|Caenorhabditis elegans Ferritin prot...    52   4e-07
AF016447-16|AAG24016.1|  170|Caenorhabditis elegans Ferritin pro...    46   2e-05
Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical pr...    29   2.4  
AF000261-10|AAB52930.1|  639|Caenorhabditis elegans Hypothetical...    29   2.4  
Z82082-8|CAE53736.1|   83|Caenorhabditis elegans Hypothetical pr...    29   3.2  
Z69302-8|CAA93261.3|  420|Caenorhabditis elegans Hypothetical pr...    29   4.3  

>AF106592-2|AAK21364.1|  170|Caenorhabditis elegans Ferritin protein
           2 protein.
          Length = 170

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/58 (46%), Positives = 35/58 (60%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + KQI  E+ AS  YL+M  YF  D V  P  AK F + + EEREHAT+L+    +RG
Sbjct: 16  VNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRG 73



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/60 (36%), Positives = 32/60 (53%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           +Q P N  W +   A E AL LE     S+ ++  T   + ND HL D++  ++LDEQ K
Sbjct: 81  IQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTA-GNHNDAHLTDFIEEKYLDEQVK 139


>AF016447-16|AAG24016.1|  170|Caenorhabditis elegans Ferritin
           protein 1 protein.
          Length = 170

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/58 (41%), Positives = 34/58 (58%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + KQI  E+ AS  YL+M A+F  D +     AK F + + EER HAT+L+    +RG
Sbjct: 16  VNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRG 73



 Score = 34.7 bits (76), Expect = 0.065
 Identities = 19/59 (32%), Positives = 30/59 (50%)
 Frame = +2

Query: 497 HVQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           ++Q P    W +   A E AL LE     S+ ++    E   ND HL +Y+  ++L+EQ
Sbjct: 80  NIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQR-NDAHLTNYIQEKYLEEQ 137


>Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical
           protein F58G11.2 protein.
          Length = 960

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +1

Query: 493 SSRTGPRKHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQ 618
           +S++ PR H  G+ R S  A  +  + R+  H GGH   R Q
Sbjct: 204 NSQSSPRSHQGGQDRYS--APKEDNQRRYDNHQGGHDSYRGQ 243


>AF000261-10|AAB52930.1|  639|Caenorhabditis elegans Hypothetical
           protein F19B10.10 protein.
          Length = 639

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = -3

Query: 153 SYNHRFFDDIQKNMCS*KQ*LYKSSLY 73
           SYNHRFF  I K++ S K+ LYK+ ++
Sbjct: 99  SYNHRFF--IHKDISSDKKFLYKNDIF 123


>Z82082-8|CAE53736.1|   83|Caenorhabditis elegans Hypothetical
           protein ZC334.11 protein.
          Length = 83

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = -3

Query: 624 LKLLSQVLMTSRMLLVTSLSSLRACSRADAPLSHDVFAGPC 502
           L LL  +++T+   L  S ++ R C R   P  + +  GPC
Sbjct: 6   LILLCALVLTTMAFLAPSTAAKRRCGRRLIPYVYSICGGPC 46


>Z69302-8|CAA93261.3|  420|Caenorhabditis elegans Hypothetical
           protein F40F8.5 protein.
          Length = 420

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = -3

Query: 252 DGDGADVTLCSCGRN*GSNESEDSKENSPHLNFS-YNHR 139
           D D +D T+   G N     SED   N P+++ + +NHR
Sbjct: 259 DDDPSDTTIDHTGHNHRRRRSEDHDPNDPNVDHTGHNHR 297


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,711,129
Number of Sequences: 27780
Number of extensions: 297158
Number of successful extensions: 839
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 839
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1624019012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -