SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical pr...   161   3e-40
M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein ( C.ele...   158   4e-39
Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical pr...   141   4e-34
Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical pr...   141   4e-34
Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical pr...   141   5e-34
AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock pr...   126   2e-29
U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock prot...   122   3e-28
M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C. el...   122   3e-28
X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.       102   2e-22
U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock prot...   102   2e-22
Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical p...    91   7e-19
Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical pr...    91   7e-19
Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical pr...    72   4e-13
U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical pr...    60   1e-09
L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical pr...    58   8e-09
Z67884-4|CAH60753.1|  905|Caenorhabditis elegans Hypothetical pr...    54   1e-07
Z67884-3|CAA91809.2|  921|Caenorhabditis elegans Hypothetical pr...    54   1e-07
M28528-1|AAA28076.1|  288|Caenorhabditis elegans protein ( C.ele...    50   1e-06
AF101318-8|AAC69343.2|  342|Caenorhabditis elegans Hypothetical ...    33   0.20 
Z92815-4|CAB07294.2| 2175|Caenorhabditis elegans Hypothetical pr...    31   0.62 
Z83217-4|CAB05683.2| 1178|Caenorhabditis elegans Hypothetical pr...    30   1.4  
U53341-6|AAC69106.1|  790|Caenorhabditis elegans Hypothetical pr...    30   1.9  
U53341-5|AAL06020.1|  842|Caenorhabditis elegans Hypothetical pr...    30   1.9  
AC006648-4|AAF39852.2|   71|Caenorhabditis elegans Hypothetical ...    30   1.9  
Z82073-3|CAB04926.1|  631|Caenorhabditis elegans Hypothetical pr...    29   3.3  
U61949-2|AAB03152.1|  884|Caenorhabditis elegans Puromycin-sensi...    29   3.3  
U61949-1|AAY44009.1|  948|Caenorhabditis elegans Puromycin-sensi...    29   3.3  
Z73977-1|CAA98290.1|  573|Caenorhabditis elegans Hypothetical pr...    28   7.7  
L08403-5|AAT92077.1|  531|Caenorhabditis elegans Hypothetical pr...    28   7.7  
L08403-4|AAA28021.1|  529|Caenorhabditis elegans Hypothetical pr...    28   7.7  

>Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical
           protein F26D10.3 protein.
          Length = 640

 Score =  161 bits (392), Expect = 3e-40
 Identities = 76/81 (93%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF  EFKRK+KKD
Sbjct: 194 RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKD 253

Query: 191 LATNKRALRRLRTACERAKRT 253
           LA+N RALRRLRTACERAKRT
Sbjct: 254 LASNPRALRRLRTACERAKRT 274



 Score =  159 bits (385), Expect = 2e-39
 Identities = 77/88 (87%), Positives = 83/88 (94%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSS+QASIEIDSLFEGIDFYT+ITRARFEEL ADLFRSTM+PVEKSLRDAKMDK+Q
Sbjct: 272 KRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQ 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HDIVLVGGSTRIPKVQKLL D F+GKE
Sbjct: 332 VHDIVLVGGSTRIPKVQKLLSDLFSGKE 359



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 43/72 (59%), Positives = 43/72 (59%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 358 KELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKR 417

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK  QTF
Sbjct: 418 NTTIPTKTAQTF 429


>M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein (
           C.elegans heat shockprotein 70A gene, complete cds. ).
          Length = 640

 Score =  158 bits (383), Expect = 4e-39
 Identities = 77/87 (88%), Positives = 82/87 (94%)
 Frame = +1

Query: 247 EDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQI 426
           E LSSS QASIEIDSLFEGIDFYT+ITRARFEEL ADLFRSTM+PVEKSLRDAKMDK+Q+
Sbjct: 273 ETLSSSCQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQV 332

Query: 427 HDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           HDIVLVGGSTRIPKVQKLL D F+GKE
Sbjct: 333 HDIVLVGGSTRIPKVQKLLSDLFSGKE 359



 Score =  157 bits (382), Expect = 6e-39
 Identities = 74/81 (91%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF  EFKRK+KKD
Sbjct: 194 RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKD 253

Query: 191 LATNKRALRRLRTACERAKRT 253
           LA+N RALRRLRTACERA  T
Sbjct: 254 LASNPRALRRLRTACERANET 274



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 43/72 (59%), Positives = 43/72 (59%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 358 KELNKSINPDEALAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKR 417

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK  QTF
Sbjct: 418 NTTIPTKTAQTF 429


>Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.5 protein.
          Length = 645

 Score =  141 bits (342), Expect = 4e-34
 Identities = 65/88 (73%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSS++A +E+DSLFEGID  T ITRARFEEL ADLFR T+EPVEK+LRDAK+DK++
Sbjct: 272 KRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSK 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I ++VLVGGSTR+PK+QKLL+DFFNGKE
Sbjct: 332 IDEVVLVGGSTRVPKIQKLLKDFFNGKE 359



 Score =  137 bits (332), Expect = 6e-33
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           +NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  K
Sbjct: 193 KNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGK 252

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D++ N RA+RRLRTACERAKRT
Sbjct: 253 DISPNPRAIRRLRTACERAKRT 274



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 34/72 (47%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N SINPDE           +L G K E ++D           GIETAGGVMT LI R
Sbjct: 358 KELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDR 417

Query: 681 NTTIPTKQTQTF 716
           NT IPTK  +TF
Sbjct: 418 NTRIPTKACKTF 429


>Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.4 protein.
          Length = 645

 Score =  141 bits (342), Expect = 4e-34
 Identities = 65/88 (73%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSS++A +E+DSLFEGID  T ITRARFEEL ADLFR T+EPVEK+LRDAK+DK++
Sbjct: 272 KRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSK 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I ++VLVGGSTR+PK+QKLL+DFFNGKE
Sbjct: 332 IDEVVLVGGSTRVPKIQKLLKDFFNGKE 359



 Score =  137 bits (332), Expect = 6e-33
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           +NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  K
Sbjct: 193 KNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGK 252

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D++ N RA+RRLRTACERAKRT
Sbjct: 253 DISPNPRAIRRLRTACERAKRT 274



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 34/72 (47%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N SINPDE           +L G K E ++D           GIETAGGVMT LI R
Sbjct: 358 KELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDR 417

Query: 681 NTTIPTKQTQTF 716
           NT IPTK  +TF
Sbjct: 418 NTRIPTKACKTF 429


>Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical
           protein C12C8.1 protein.
          Length = 643

 Score =  141 bits (341), Expect = 5e-34
 Identities = 64/88 (72%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSST+A++E+DSLF+G DFY+ ITRARFEEL ADLFR T+EPVEK+LRDAK DK +
Sbjct: 272 KRTLSSSTEATVEVDSLFDGTDFYSKITRARFEELCADLFRKTLEPVEKALRDAKTDKGR 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I ++VLVGGSTRIPK+QKLL++FFNGK+
Sbjct: 332 IDEVVLVGGSTRIPKIQKLLKEFFNGKD 359



 Score =  136 bits (329), Expect = 1e-32
 Identities = 63/82 (76%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           +N+LIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD+R++ HF+ EFKRK  K
Sbjct: 193 KNILIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDSRVLQHFMTEFKRKTGK 252

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D+++N RA+RRLRTACERAKRT
Sbjct: 253 DISSNPRAIRRLRTACERAKRT 274



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 32/72 (44%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N SINPDE           +L G K + ++D           GIETAGGVMT LI R
Sbjct: 358 KDLNCSINPDEAVAFGAAVQAAVLSGVKDDTIKDVLLVDVVPLSHGIETAGGVMTNLIDR 417

Query: 681 NTTIPTKQTQTF 716
           NT IP K ++TF
Sbjct: 418 NTRIPAKASKTF 429


>AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock
           protein protein 4 protein.
          Length = 657

 Score =  126 bits (303), Expect = 2e-29
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LS+  Q  IEI+SLF+G DF  ++TRA+FEELN DLFR+T++PV+K L DA M K
Sbjct: 296 KAKRALSTQHQTKIEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDADMKK 355

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
             +H+IVLVGGSTRIPKVQ+L++D+FNGKEP
Sbjct: 356 TDVHEIVLVGGSTRIPKVQQLIKDYFNGKEP 386



 Score =  113 bits (273), Expect = 9e-26
 Identities = 49/87 (56%), Positives = 68/87 (78%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RN+L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++ +F++ +K+K  KD
Sbjct: 220 RNILVFDLGGGTFDVSLLTIDSGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKD 279

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           L  + RA+++LR   E+AKR     H+
Sbjct: 280 LRKDNRAVQKLRREVEKAKRALSTQHQ 306



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 29/72 (40%), Positives = 35/72 (48%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  ++ INPDE           ++ G   E   D           GIET GGVMT LI R
Sbjct: 384 KEPSRGINPDEAVAYGAAVQAGVIGG--VENTGDVVLLDVNPLTLGIETVGGVMTKLIGR 441

Query: 681 NTTIPTKQTQTF 716
           NT IPTK++Q F
Sbjct: 442 NTVIPTKKSQVF 453


>U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock protein
           protein 3 protein.
          Length = 661

 Score =  122 bits (293), Expect = 3e-28
 Identities = 54/91 (59%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LS+  Q  +EI+SLF+G DF  ++TRA+FEELN DLFR+T++PV+K L D+ + K
Sbjct: 299 KAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKK 358

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
             +H+IVLVGGSTRIPKVQ+L+++FFNGKEP
Sbjct: 359 DDVHEIVLVGGSTRIPKVQQLIKEFFNGKEP 389



 Score =  116 bits (278), Expect = 2e-26
 Identities = 50/87 (57%), Positives = 70/87 (80%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RN+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ +F++ +K+K  KD
Sbjct: 223 RNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKD 282

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           L  +KRA+++LR   E+AKR     H+
Sbjct: 283 LRKDKRAVQKLRREVEKAKRALSTQHQ 309



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 30/85 (35%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           ++ G+  E+  +           GI
Sbjct: 374 PKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGE--EDTGEIVLLDVNPLTMGI 431

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT IPTK++Q F
Sbjct: 432 ETVGGVMTKLIGRNTVIPTKKSQVF 456


>M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C.
           elegans BiP (hsp3)gene, complete cds. ).
          Length = 661

 Score =  122 bits (293), Expect = 3e-28
 Identities = 54/91 (59%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LS+  Q  +EI+SLF+G DF  ++TRA+FEELN DLFR+T++PV+K L D+ + K
Sbjct: 299 KAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKK 358

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
             +H+IVLVGGSTRIPKVQ+L+++FFNGKEP
Sbjct: 359 DDVHEIVLVGGSTRIPKVQQLIKEFFNGKEP 389



 Score =  116 bits (278), Expect = 2e-26
 Identities = 50/87 (57%), Positives = 70/87 (80%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RN+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ +F++ +K+K  KD
Sbjct: 223 RNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKD 282

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           L  +KRA+++LR   E+AKR     H+
Sbjct: 283 LRKDKRAVQKLRREVEKAKRALSTQHQ 309



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 30/85 (35%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           ++ G+  E+  +           GI
Sbjct: 374 PKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGE--EDTGEIVLLDVNPLTMGI 431

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT IPTK++Q F
Sbjct: 432 ETVGGVMTKLIGRNTVIPTKKSQVF 456


>X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.
          Length = 487

 Score =  102 bits (245), Expect = 2e-22
 Identities = 46/77 (59%), Positives = 61/77 (79%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFDVSIL I+ G+FEVKST GDT LGGEDFD+ +V+H V EFK++   DL 
Sbjct: 219 IAVYDLGGGTFDVSILEIQKGVFEVKSTNGDTFLGGEDFDHALVHHLVGEFKKEQGVDLT 278

Query: 197 TNKRALRRLRTACERAK 247
            + +A++RLR A E+AK
Sbjct: 279 KDPQAMQRLREAAEKAK 295



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 37/95 (38%), Positives = 57/95 (60%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS+TQ  I +  +             +TRA+FE++  DL + T+EP    L DA
Sbjct: 293 KAKCELSSTTQTDINLPYITMDQSGPKHLNLKLTRAKFEQIVGDLIKRTIEPCRNVLHDA 352

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++  +QI D++LVGG +R+PKVQ  +Q+ F GK P
Sbjct: 353 EVKSSQIADVLLVGGMSRMPKVQATVQEIF-GKVP 386



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 31/72 (43%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K++NPDE           +L GD    V D           GIET GG+MT LI R
Sbjct: 384 KVPSKAVNPDEAVAMGAAIQGAVLAGD----VTDVLLLDVTPLSLGIETLGGIMTKLITR 439

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 440 NTTIPTKKSQVF 451


>U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock protein
           protein 6 protein.
          Length = 657

 Score =  102 bits (245), Expect = 2e-22
 Identities = 46/77 (59%), Positives = 61/77 (79%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFDVSIL I+ G+FEVKST GDT LGGEDFD+ +V+H V EFK++   DL 
Sbjct: 219 IAVYDLGGGTFDVSILEIQKGVFEVKSTNGDTFLGGEDFDHALVHHLVGEFKKEQGVDLT 278

Query: 197 TNKRALRRLRTACERAK 247
            + +A++RLR A E+AK
Sbjct: 279 KDPQAMQRLREAAEKAK 295



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS+TQ  I +  +             +TRA+FE++  DL + T+EP  K+L DA
Sbjct: 293 KAKCELSSTTQTDINLPYITMDQSGPKHLNLKLTRAKFEQIVGDLIKRTIEPCRKALHDA 352

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++  +QI D++LVGG +R+PKVQ  +Q+ F GK P
Sbjct: 353 EVKSSQIADVLLVGGMSRMPKVQATVQEIF-GKVP 386



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 31/72 (43%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K++NPDE           +L GD    V D           GIET GG+MT LI R
Sbjct: 384 KVPSKAVNPDEAVAMGAAIQGAVLAGD----VTDVLLLDVTPLSLGIETLGGIMTKLITR 439

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 440 NTTIPTKKSQVF 451


>Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 91.1 bits (216), Expect = 7e-19
 Identities = 42/83 (50%), Positives = 59/83 (71%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           +RRN+LI+DLGGGTFDV+ + ++     VK+  GDTHLGG+D DN ++   ++EFK ++ 
Sbjct: 188 SRRNILIYDLGGGTFDVAAVNVDGPRITVKAKGGDTHLGGQDIDNIIMIKMLEEFKNRHG 247

Query: 185 KDLATNKRALRRLRTACERAKRT 253
            DL  N RAL+R+R A E AK T
Sbjct: 248 IDLKGNYRALKRIRKAAEVAKIT 270



 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 37/84 (44%), Positives = 57/84 (67%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+S+ A IE++ L  GIDF   I+R  FE    +L  +T+  VE+ +R+A + K+Q
Sbjct: 268 KITLSASSVARIELECLHLGIDFIMRISRTDFESWIENLLMATVIHVERVIREANLKKSQ 327

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           I++IVLVGGSTRIP ++ +++  F
Sbjct: 328 INEIVLVGGSTRIPILKNIIKQSF 351



 Score = 35.5 bits (78), Expect = 0.038
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           +SI+PDE           +L G  +EEVQD           G++     M+ LIK+ T  
Sbjct: 359 ESIHPDEAVAYGAAIMAAVLSG--AEEVQDMRLIDVIPMSIGVQCNRDYMSVLIKKGTVF 416

Query: 693 PTKQTQTF 716
           P  + +TF
Sbjct: 417 PCTKRKTF 424


>Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 91.1 bits (216), Expect = 7e-19
 Identities = 42/83 (50%), Positives = 59/83 (71%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           +RRN+LI+DLGGGTFDV+ + ++     VK+  GDTHLGG+D DN ++   ++EFK ++ 
Sbjct: 188 SRRNILIYDLGGGTFDVAAVNVDGPRITVKAKGGDTHLGGQDIDNIIMIKMLEEFKNRHG 247

Query: 185 KDLATNKRALRRLRTACERAKRT 253
            DL  N RAL+R+R A E AK T
Sbjct: 248 IDLKGNYRALKRIRKAAEVAKIT 270



 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 37/84 (44%), Positives = 57/84 (67%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+S+ A IE++ L  GIDF   I+R  FE    +L  +T+  VE+ +R+A + K+Q
Sbjct: 268 KITLSASSVARIELECLHLGIDFIMRISRTDFESWIENLLMATVIHVERVIREANLKKSQ 327

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           I++IVLVGGSTRIP ++ +++  F
Sbjct: 328 INEIVLVGGSTRIPILKNIIKQSF 351



 Score = 35.5 bits (78), Expect = 0.038
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           +SI+PDE           +L G  +EEVQD           G++     M+ LIK+ T  
Sbjct: 359 ESIHPDEAVAYGAAIMAAVLSG--AEEVQDMRLIDVIPMSIGVQCNRDYMSVLIKKGTVF 416

Query: 693 PTKQTQTF 716
           P  + +TF
Sbjct: 417 PCTKRKTF 424


>Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical
           protein F54C9.2 protein.
          Length = 450

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 30/78 (38%), Positives = 52/78 (66%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV++ DLGGGT DVS+L ++ G+F  ++ AG+  LGG+DF++R+  H + +   K+ K +
Sbjct: 228 NVVVVDLGGGTLDVSVLWLQGGVFVTQAMAGNNRLGGQDFNDRVQKHLISKIAEKFGKTI 287

Query: 194 ATNKRALRRLRTACERAK 247
             NK  ++++R   E+ K
Sbjct: 288 -DNKEDIQQIRMEVEKGK 304



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 33/86 (38%), Positives = 52/86 (60%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           +GK  L++    +I ++    G   Y  +TR  FE LN DL ++   P+  +L DA +D 
Sbjct: 302 KGKIRLTNVPSTTISLNLKTVGKWNY-ELTRDEFETLNGDLLKAIELPITAALADANLDT 360

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFF 495
           A + +IVLVGGST++P V+K++  FF
Sbjct: 361 ADVDEIVLVGGSTQVPAVRKIVGRFF 386


>U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical
           protein T24H7.2 protein.
          Length = 925

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 32/88 (36%), Positives = 51/88 (57%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ +   +I+S  E ID    +TR  F  L +D+     EP+E++LR A++    
Sbjct: 306 KQVLSANAEHFAQIESAHEDIDAKLKVTREDFNHLISDMESRFGEPIEQALRMAQIPIDD 365

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I   VL+G  TR+PKVQ+++Q     KE
Sbjct: 366 IDQFVLMGAGTRVPKVQEIVQKTIGTKE 393



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +2

Query: 107 DTHLGGEDFDNRMVNHFVQEFKRKY--KKDLATNKRALRRLRTACERAKR 250
           D  LGG +  NR+ +H ++ F++ Y  K  + TN+RA+ +     ER K+
Sbjct: 258 DRTLGGIEMTNRLRDHLIEMFEKNYKPKTKVNTNRRAMTKFSKEAERLKQ 307


>L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical
           protein C30C11.4 protein.
          Length = 776

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 30/80 (37%), Positives = 43/80 (53%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G  +   S++    G  ++ +T+ D   GG  FD  +  HF +EFK KY  D
Sbjct: 198 RNVVFLDIGHSSTQASLVAFNRGKLQMVNTSYDLESGGIWFDALIREHFRKEFKTKYGID 257

Query: 191 LATNKRALRRLRTACERAKR 250
            AT+ R   RL   CER K+
Sbjct: 258 AATSPRPWLRLLDECERVKK 277



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+  ++ T   + I+   E  D    + R  FE+L A +F    + +     D    K +
Sbjct: 277 KQMSANQTPIPLNIECFMEDKDVTGKMQRQEFEDLAAPIFNRIKQVLINLFADGVSIKPE 336

Query: 424 -IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            I +I +VGGS+RIP ++++++D F GKEP
Sbjct: 337 EIDEIEIVGGSSRIPMIREIVKDLF-GKEP 365


>Z67884-4|CAH60753.1|  905|Caenorhabditis elegans Hypothetical
           protein T14G8.3b protein.
          Length = 905

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++     +++SLFE  +F   +TR   E++  DL      P+  ++  A++    
Sbjct: 293 KQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTND 352

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I  +VL+G  TR+PKV+++L+     KE
Sbjct: 353 IDLVVLMGAGTRVPKVKEILKTILKDKE 380



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +2

Query: 107 DTHLGGEDFDNRMVNHFVQEFKRKYK--KDLATNKRALRRLRTACERAKR 250
           D  LGG +  NR+ +H  + F+   K  KD++TN RA+ +L    ER K+
Sbjct: 245 DKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERVKQ 294


>Z67884-3|CAA91809.2|  921|Caenorhabditis elegans Hypothetical
           protein T14G8.3a protein.
          Length = 921

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++     +++SLFE  +F   +TR   E++  DL      P+  ++  A++    
Sbjct: 309 KQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTND 368

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I  +VL+G  TR+PKV+++L+     KE
Sbjct: 369 IDLVVLMGAGTRVPKVKEILKTILKDKE 396



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +2

Query: 107 DTHLGGEDFDNRMVNHFVQEFKRKYK--KDLATNKRALRRLRTACERAKR 250
           D  LGG +  NR+ +H  + F+   K  KD++TN RA+ +L    ER K+
Sbjct: 261 DKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERVKQ 310


>M28528-1|AAA28076.1|  288|Caenorhabditis elegans protein (
           C.elegans heat shockprotein 4 gene, 3' end. ).
          Length = 288

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 29/72 (40%), Positives = 35/72 (48%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  ++ INPDE           ++ G   E   D           GIET GGVMT LI R
Sbjct: 15  KEPSRGINPDEAVAYGAAVQAGVIGG--VENTGDVVLLDVNPLTLGIETVGGVMTKLIGR 72

Query: 681 NTTIPTKQTQTF 716
           NT IPTK++Q F
Sbjct: 73  NTVIPTKKSQVF 84



 Score = 35.1 bits (77), Expect = 0.051
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +1

Query: 460 IPKVQKLLQDFFNGKEP 510
           IPKVQ+L++D+FNGKEP
Sbjct: 1   IPKVQQLIKDYFNGKEP 17


>AF101318-8|AAC69343.2|  342|Caenorhabditis elegans Hypothetical
           protein Y73C8C.2 protein.
          Length = 342

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 24/59 (40%), Positives = 32/59 (54%)
 Frame = +3

Query: 24  SLTSAAVPSTCPSLPSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLP 200
           SLT+   PST  SLP+  +S+     P T T  VRT T  W+   S + + +TKRT  P
Sbjct: 150 SLTTTTAPST--SLPTSTISTT---KPTTTT-SVRTTT-QWNAVTSTTLQQSTKRTGCP 201


>Z92815-4|CAB07294.2| 2175|Caenorhabditis elegans Hypothetical
           protein W01F3.3 protein.
          Length = 2175

 Score = 31.5 bits (68), Expect = 0.62
 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 3/60 (5%)
 Frame = +3

Query: 39  AVPST---CPSLPSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLPTRE 209
           AVP+T    PS P+  VS++  P P TP    R    A  TT +R+SR  T R  + T E
Sbjct: 631 AVPTTTPLAPSAPTVRVSTQRAPVPTTP----RPTAPAVQTTTTRASRLETTRVPVKTVE 686


>Z83217-4|CAB05683.2| 1178|Caenorhabditis elegans Hypothetical
           protein C10C6.6 protein.
          Length = 1178

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 7/106 (6%)
 Frame = -3

Query: 677 LDECGHDTSSSLNTEG---KGCYIKQQQILHLLRLVTVQDSSLDSCTISYGLVRVNRFVG 507
           +D C  D + +L T+    +G  +  Q+   +     +   SL      + LVR    + 
Sbjct: 477 VDICCFDKTGTLTTDNLVVEGVALNNQKEGMIRNAEDLPHESLQVLASCHSLVRFEEDLV 536

Query: 506 SFPLKKSCRSFC----TLGIRVEPPTSTISWI*ALSILASRRDFST 381
             PL+K+C S+C    T G  V PP +    I  + I   R  FS+
Sbjct: 537 GDPLEKACLSWCGWNLTKGDAVMPPKTAAKGISGIKIF-HRYHFSS 581


>U53341-6|AAC69106.1|  790|Caenorhabditis elegans Hypothetical
           protein F49E10.2a protein.
          Length = 790

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 17/55 (30%), Positives = 26/55 (47%)
 Frame = +3

Query: 30  TSAAVPSTCPSLPSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTS 194
           T+  VPST P+  +   ++   P  +T T    T T   STT + + +  T  TS
Sbjct: 599 TTTTVPSTTPTSTTTTTTTTPKPTTSTSTSTSTTTTTTTSTTATTTPQPTTTTTS 653


>U53341-5|AAL06020.1|  842|Caenorhabditis elegans Hypothetical
           protein F49E10.2b protein.
          Length = 842

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 17/55 (30%), Positives = 26/55 (47%)
 Frame = +3

Query: 30  TSAAVPSTCPSLPSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTS 194
           T+  VPST P+  +   ++   P  +T T    T T   STT + + +  T  TS
Sbjct: 599 TTTTVPSTTPTSTTTTTTTTPKPTTSTSTSTSTTTTTTTSTTATTTPQPTTTTTS 653


>AC006648-4|AAF39852.2|   71|Caenorhabditis elegans Hypothetical
           protein F59H6.3 protein.
          Length = 71

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = +3

Query: 96  PPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLP 200
           PPP TPTW V  L + W+    R  R  T   S P
Sbjct: 21  PPPNTPTWTV--LFVNWTIIHHRLQRSPTPAASWP 53


>Z82073-3|CAB04926.1|  631|Caenorhabditis elegans Hypothetical
           protein W06D12.5 protein.
          Length = 631

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = -1

Query: 241 PLTCSTQTPKSSLVGSEVLFVFPLELLDKVVDHAIVKVLTSQVGVAGGGF 92
           P T   Q   S   GSEV    P E+L+ +   +I   + S   + GGGF
Sbjct: 535 PSTPKVQRALSVDAGSEVQDETPNEILNNLTVRSIATFMKSNADIYGGGF 584


>U61949-2|AAB03152.1|  884|Caenorhabditis elegans
           Puromycin-sensitive aminopeptidaseprotein 1, isoform a
           protein.
          Length = 884

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = +1

Query: 241 GKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPV-EKSLR 399
           G + L +S    +EID+  E  + Y SIT A+   +N  L     EPV +K LR
Sbjct: 370 GLDALRNSHPIEVEIDNPNELDEIYDSITYAKSNSVNRMLCYYLSEPVFQKGLR 423


>U61949-1|AAY44009.1|  948|Caenorhabditis elegans
           Puromycin-sensitive aminopeptidaseprotein 1, isoform b
           protein.
          Length = 948

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = +1

Query: 241 GKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPV-EKSLR 399
           G + L +S    +EID+  E  + Y SIT A+   +N  L     EPV +K LR
Sbjct: 434 GLDALRNSHPIEVEIDNPNELDEIYDSITYAKSNSVNRMLCYYLSEPVFQKGLR 487


>Z73977-1|CAA98290.1|  573|Caenorhabditis elegans Hypothetical
           protein T28B11.1 protein.
          Length = 573

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 245 KRTCHRPHKRALR*ILSLRVLTSTRQLLVLASRS*TPI 358
           +RTC  PH +  R ++ L+    +R++++   R  +PI
Sbjct: 453 ERTCRIPHPKDRRVVIQLKYCKPSRRMVLTIEREDSPI 490


>L08403-5|AAT92077.1|  531|Caenorhabditis elegans Hypothetical
           protein F42H10.7b protein.
          Length = 531

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 10/28 (35%), Positives = 13/28 (46%)
 Frame = -1

Query: 454 WSHPPVQYRGFEPYPSWHHGETSPLAPW 371
           WS P    R   P  +W  G T+P + W
Sbjct: 463 WSRPSSSKRSTTPGSAWSRGSTTPGSSW 490


>L08403-4|AAA28021.1|  529|Caenorhabditis elegans Hypothetical
           protein F42H10.7a protein.
          Length = 529

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 10/28 (35%), Positives = 13/28 (46%)
 Frame = -1

Query: 454 WSHPPVQYRGFEPYPSWHHGETSPLAPW 371
           WS P    R   P  +W  G T+P + W
Sbjct: 461 WSRPSSSKRSTTPGSAWSRGSTTPGSSW 488


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,970,459
Number of Sequences: 27780
Number of extensions: 364153
Number of successful extensions: 1227
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 1129
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1222
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1676746902
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -