SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20035
         (493 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC087079-7|AAK27870.1|  145|Caenorhabditis elegans Hypothetical ...   101   2e-22
AC087079-8|AAK27871.1|   88|Caenorhabditis elegans Hypothetical ...    39   0.002
Z82258-4|CAL44968.1| 1467|Caenorhabditis elegans Hypothetical pr...    28   3.2  
Z82258-3|CAL44967.1| 1538|Caenorhabditis elegans Hypothetical pr...    28   3.2  
Z77655-1|CAB01137.1|  393|Caenorhabditis elegans Hypothetical pr...    28   3.2  
Z75550-7|CAA99925.2|  195|Caenorhabditis elegans Hypothetical pr...    28   3.2  
AL023835-19|CAL44978.1| 1467|Caenorhabditis elegans Hypothetical...    28   3.2  
AL023835-18|CAL44977.1| 1538|Caenorhabditis elegans Hypothetical...    28   3.2  
AF067219-10|AAC17031.1|  753|Caenorhabditis elegans Hypothetical...    28   4.2  
AF003133-2|AAB54136.1|  753|Caenorhabditis elegans Hypothetical ...    28   4.2  
U39472-5|AAK31393.1|  128|Caenorhabditis elegans Hypothetical pr...    27   5.6  
U41995-1|AAA83459.1|  301|Caenorhabditis elegans Serpentine rece...    27   7.4  
Z81532-2|CAB04324.1|  290|Caenorhabditis elegans Hypothetical pr...    27   9.8  
Z81465-2|CAB03861.1| 1642|Caenorhabditis elegans Hypothetical pr...    27   9.8  
U28735-3|AAF99958.3|  467|Caenorhabditis elegans Glycosylation r...    27   9.8  
U28735-2|AAM69111.1|  543|Caenorhabditis elegans Glycosylation r...    27   9.8  
AF082011-1|AAD03023.1|  467|Caenorhabditis elegans UDP-N-acetylg...    27   9.8  

>AC087079-7|AAK27870.1|  145|Caenorhabditis elegans Hypothetical
           protein Y37E3.8a protein.
          Length = 145

 Score =  101 bits (243), Expect = 2e-22
 Identities = 43/78 (55%), Positives = 54/78 (69%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           MA + +KTRKLRGHVS                 NAGG+HHHRIN DKYHPGYFGK+GMR 
Sbjct: 1   MAHALRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGQHHHRINRDKYHPGYFGKVGMRV 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           FH  KN+++CP +N+++L
Sbjct: 61  FHLNKNQHYCPTVNVERL 78



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 27/88 (30%), Positives = 36/88 (40%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           F L K Q +  +  +   W+LV ++ R K   A  GK PVI+  K            P+ 
Sbjct: 61  FHLNKNQHYCPTVNVERLWSLVPQEVRDK---ATGGKSPVIDCTKLGYFKVLGKGLLPET 117

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           P+IV                GGACVL A
Sbjct: 118 PLIVKARFFSHEAEQKIKKAGGACVLVA 145


>AC087079-8|AAK27871.1|   88|Caenorhabditis elegans Hypothetical
           protein Y37E3.8b protein.
          Length = 88

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 27/88 (30%), Positives = 36/88 (40%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           F L K Q +  +  +   W+LV ++ R K   A  GK PVI+  K            P+ 
Sbjct: 4   FHLNKNQHYCPTVNVERLWSLVPQEVRDK---ATGGKSPVIDCTKLGYFKVLGKGLLPET 60

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           P+IV                GGACVL A
Sbjct: 61  PLIVKARFFSHEAEQKIKKAGGACVLVA 88



 Score = 31.9 bits (69), Expect = 0.26
 Identities = 10/21 (47%), Positives = 17/21 (80%)
 Frame = +1

Query: 193 MRNFHFRKNKNFCPVLNLDKL 255
           MR FH  KN+++CP +N+++L
Sbjct: 1   MRVFHLNKNQHYCPTVNVERL 21


>Z82258-4|CAL44968.1| 1467|Caenorhabditis elegans Hypothetical
           protein Y37A1B.17b protein.
          Length = 1467

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 335 SWILQVARQRQTPQTTCHSKSKVLLKISREENQGC 439
           SW+ +++   Q P+T C      ++K+ REE   C
Sbjct: 5   SWV-RISNATQDPETRCSVAQDQIVKVVREEGDWC 38


>Z82258-3|CAL44967.1| 1538|Caenorhabditis elegans Hypothetical
           protein Y37A1B.17a protein.
          Length = 1538

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 335 SWILQVARQRQTPQTTCHSKSKVLLKISREENQGC 439
           SW+ +++   Q P+T C      ++K+ REE   C
Sbjct: 5   SWV-RISNATQDPETRCSVAQDQIVKVVREEGDWC 38


>Z77655-1|CAB01137.1|  393|Caenorhabditis elegans Hypothetical
           protein C56A3.1 protein.
          Length = 393

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -3

Query: 128 PALPRPPGCLRCFPIRPCP 72
           PA P+ P C  C P +PCP
Sbjct: 50  PACPQAPSCPVCPPPQPCP 68


>Z75550-7|CAA99925.2|  195|Caenorhabditis elegans Hypothetical
           protein T22C1.9 protein.
          Length = 195

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 5/69 (7%)
 Frame = +1

Query: 25  ATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMD-----KYHPGYFGKL 189
           +T  KK+ K  GH                   N GG   H + M+     ++ P  F KL
Sbjct: 127 STKSKKSEKDVGHDDHKKEDVHGDQKDDNKDRNDGGRDSHVVQMEHNSEEEHEPSGFKKL 186

Query: 190 GMRNFHFRK 216
           G   F+F+K
Sbjct: 187 GKSFFNFKK 195


>AL023835-19|CAL44978.1| 1467|Caenorhabditis elegans Hypothetical
           protein Y37A1B.17b protein.
          Length = 1467

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 335 SWILQVARQRQTPQTTCHSKSKVLLKISREENQGC 439
           SW+ +++   Q P+T C      ++K+ REE   C
Sbjct: 5   SWV-RISNATQDPETRCSVAQDQIVKVVREEGDWC 38


>AL023835-18|CAL44977.1| 1538|Caenorhabditis elegans Hypothetical
           protein Y37A1B.17a protein.
          Length = 1538

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 335 SWILQVARQRQTPQTTCHSKSKVLLKISREENQGC 439
           SW+ +++   Q P+T C      ++K+ REE   C
Sbjct: 5   SWV-RISNATQDPETRCSVAQDQIVKVVREEGDWC 38


>AF067219-10|AAC17031.1|  753|Caenorhabditis elegans Hypothetical
           protein R12E2.10 protein.
          Length = 753

 Score = 27.9 bits (59), Expect = 4.2
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 281 AEVCICSRWQGPRHQYCQSWILQVARQRQ 367
           AE+ ICS  +GP ++Y     +Q  RQR+
Sbjct: 613 AEIAICSLLRGPTYKYPVQRAVQFLRQRR 641


>AF003133-2|AAB54136.1|  753|Caenorhabditis elegans Hypothetical
           protein T21E3.1 protein.
          Length = 753

 Score = 27.9 bits (59), Expect = 4.2
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 281 AEVCICSRWQGPRHQYCQSWILQVARQRQ 367
           AE+ ICS  +GP ++Y     +Q  RQR+
Sbjct: 613 AEIAICSLLRGPTYKYPVQRAVQFLRQRR 641


>U39472-5|AAK31393.1|  128|Caenorhabditis elegans Hypothetical
           protein B0304.4 protein.
          Length = 128

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = -3

Query: 338 SFDNIDDGDLA-IWSRCILQPRLFRD*CPSLSKF 240
           S  N+  G L  IWSRCI QP  F     S+S+F
Sbjct: 14  SSGNVQKGKLLNIWSRCIAQPSSFLG--SSISRF 45


>U41995-1|AAA83459.1|  301|Caenorhabditis elegans Serpentine
           receptor, class x protein47 protein.
          Length = 301

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -2

Query: 243 VQNWTEILVLSKVEISHTKFAKVSR 169
           + NWT  L LSKV   H  F  ++R
Sbjct: 20  IANWTVFLFLSKVPSIHKSFGSLTR 44


>Z81532-2|CAB04324.1|  290|Caenorhabditis elegans Hypothetical
           protein F36F2.2 protein.
          Length = 290

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
 Frame = +1

Query: 205 HFRKNKNFCP--VLNLDKLGH*SLNRRG*SMHLLQMARSPSSILSKLD 342
           H++ +K  CP  +++  K  +  +NR   S   L   R+PS ++ KL+
Sbjct: 34  HWKISKPGCPPKIISCSKATNNDVNREKRSRRKLVKKRTPSEVIEKLE 81


>Z81465-2|CAB03861.1| 1642|Caenorhabditis elegans Hypothetical
           protein C09F9.2 protein.
          Length = 1642

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 21/75 (28%), Positives = 32/75 (42%)
 Frame = -1

Query: 403 NFAFTMTGCLGSLPLPSNL*YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRN 224
           N AF +T     + LP N       I MT       ++YF   C++ N+   +    D +
Sbjct: 97  NDAFNVTETTKKVELPPNFECKDCAIRMTTQATEYGNSYFFYSCADINIVNVIP---DGD 153

Query: 223 SCSF*SGNFSYQVCQ 179
           +C   +GN    VCQ
Sbjct: 154 TC-VGNGNRMNGVCQ 167


>U28735-3|AAF99958.3|  467|Caenorhabditis elegans Glycosylation
           related protein 12,isoform a protein.
          Length = 467

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 4/37 (10%)
 Frame = -1

Query: 124 HYHDLLD-AYGAFRYDHV---RD*HDLSAS*SSFLRW 26
           HY   LD A+  FRYDHV    D  D+     S+ RW
Sbjct: 151 HYKWALDKAFKGFRYDHVIVTEDDLDIGNDFFSYFRW 187


>U28735-2|AAM69111.1|  543|Caenorhabditis elegans Glycosylation
           related protein 12,isoform b protein.
          Length = 543

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 4/37 (10%)
 Frame = -1

Query: 124 HYHDLLD-AYGAFRYDHV---RD*HDLSAS*SSFLRW 26
           HY   LD A+  FRYDHV    D  D+     S+ RW
Sbjct: 151 HYKWALDKAFKGFRYDHVIVTEDDLDIGNDFFSYFRW 187


>AF082011-1|AAD03023.1|  467|Caenorhabditis elegans
           UDP-N-acetylglucosamine:a-3-D-mannosideb-1,
           2-N-acetylglucosaminyltransferase I protein.
          Length = 467

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 4/37 (10%)
 Frame = -1

Query: 124 HYHDLLD-AYGAFRYDHV---RD*HDLSAS*SSFLRW 26
           HY   LD A+  FRYDHV    D  D+     S+ RW
Sbjct: 151 HYKWALDKAFKGFRYDHVIVTEDDLDIGNDFFSYFRW 187


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,694,356
Number of Sequences: 27780
Number of extensions: 216357
Number of successful extensions: 573
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 552
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 572
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 924715866
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -