SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20033
         (694 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81095-2|CAB03157.1|   65|Caenorhabditis elegans Hypothetical pr...    86   3e-17
AF047660-4|AAM54169.1|   63|Caenorhabditis elegans Hypothetical ...    83   2e-16
Z73898-9|CAA98066.2|  913|Caenorhabditis elegans Hypothetical pr...    28   5.5  

>Z81095-2|CAB03157.1|   65|Caenorhabditis elegans Hypothetical
           protein F59F4.2 protein.
          Length = 65

 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 37/56 (66%), Positives = 45/56 (80%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MAPKQRM +AN+  SKN+  RGNV K+ K  ED+YP APWL+ LF+FVVCGSAVF+
Sbjct: 1   MAPKQRMTLANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFE 56


>AF047660-4|AAM54169.1|   63|Caenorhabditis elegans Hypothetical
           protein T09A12.5 protein.
          Length = 63

 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 35/56 (62%), Positives = 43/56 (76%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MAPKQRM +AN   SKN+T RGNVPK  K  E ++P + WL+ LFIFVVCGSA+F+
Sbjct: 1   MAPKQRMAVANAQFSKNVTQRGNVPKGNKTNESKFPTSQWLIGLFIFVVCGSAIFE 56


>Z73898-9|CAA98066.2|  913|Caenorhabditis elegans Hypothetical
           protein ZK822.1 protein.
          Length = 913

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = +3

Query: 453 HTYRVKTGRRYIRLLGTLSIDCRIFDEFLSLFQY--NF*RQLKPPIPLKCN 599
           H  RV+  RR I+    +  D  I +EFL LF Y  +F  +L  P   + N
Sbjct: 587 HGSRVENSRRTIKKNAIVGNDRNIEEEFLKLFSYSKDFSMELAAPPERRAN 637


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,777,071
Number of Sequences: 27780
Number of extensions: 334584
Number of successful extensions: 786
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 776
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 786
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1592382278
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -