SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20031
         (764 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL032631-5|CAA21573.1|  113|Caenorhabditis elegans Hypothetical ...    52   6e-07
AC006816-1|AAN39661.1|  401|Caenorhabditis elegans Hypothetical ...    32   0.39 
AB071420-1|BAB86940.1|  401|Caenorhabditis elegans 2-amino-3-car...    32   0.39 
Z81098-1|CAB03183.1|  581|Caenorhabditis elegans Hypothetical pr...    31   1.2  

>AL032631-5|CAA21573.1|  113|Caenorhabditis elegans Hypothetical
           protein Y106G6H.3 protein.
          Length = 113

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 2/44 (4%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLK--LFDKAK 275
           M  A K +K  E+INSRL++VMK+G+Y LGYKQTLK  L  KAK
Sbjct: 1   MAPAAKPQKNAENINSRLSMVMKTGQYVLGYKQTLKSLLNGKAK 44



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           G+ +L  +   ++L  GKAKLVIIA N PPLR
Sbjct: 25  GQYVLGYKQTLKSLLNGKAKLVIIANNTPPLR 56


>AC006816-1|AAN39661.1|  401|Caenorhabditis elegans Hypothetical
           protein Y71D11A.3b protein.
          Length = 401

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 22/45 (48%), Positives = 27/45 (60%), Gaps = 6/45 (13%)
 Frame = -1

Query: 455 FSLSSI*PYFCELFY*---TTK--GIHTSLSVRLHMHPFDKY-WE 339
           F LS+I P FCE F     TTK  GI   LSV L +HP+D + W+
Sbjct: 198 FKLSTIMPGFCEFFENWGLTTKTPGICEELSVVLFVHPWDMHMWD 242


>AB071420-1|BAB86940.1|  401|Caenorhabditis elegans
           2-amino-3-carboxylmuconate-6-semialdehydedecarboxylase
           protein.
          Length = 401

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 22/45 (48%), Positives = 27/45 (60%), Gaps = 6/45 (13%)
 Frame = -1

Query: 455 FSLSSI*PYFCELFY*---TTK--GIHTSLSVRLHMHPFDKY-WE 339
           F LS+I P FCE F     TTK  GI   LSV L +HP+D + W+
Sbjct: 198 FKLSTIMPGFCEFFENWGLTTKTPGICEELSVVLFVHPWDMHMWD 242


>Z81098-1|CAB03183.1|  581|Caenorhabditis elegans Hypothetical
           protein K07A12.1 protein.
          Length = 581

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +2

Query: 578 CWITMWGTYGVVFKLDTALWQVRIMFSIQIFYVIHRLY 691
           CW T W T  ++FKLD     + I+  I IF +  + Y
Sbjct: 244 CWETAWNTAKMIFKLDPVKDPLAIISLIDIFALKAKQY 281


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,795,343
Number of Sequences: 27780
Number of extensions: 345985
Number of successful extensions: 703
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 690
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 703
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1830096852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -