SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation fact...   275   2e-74
U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation fact...   275   2e-74
U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation fact...   265   2e-71
U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation fact...   181   3e-52
Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical pr...   180   7e-46
Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical pr...   180   7e-46
Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical pr...   161   6e-40
U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation fact...   125   4e-29
U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation f...    77   2e-14
AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial...    77   2e-14
D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation fact...    72   5e-13
D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation fact...    72   5e-13
AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongatio...    72   5e-13
L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical pr...    48   5e-06
Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical pr...    39   0.003
Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical pr...    39   0.004
AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical ...    37   0.016
Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical p...    36   0.022
M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation fact...    36   0.029
Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical pr...    36   0.038
AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical ...    35   0.066
AC024817-55|AAF59563.3|  366|Caenorhabditis elegans Hypothetical...    33   0.15 
DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic tr...    33   0.27 
Z83235-9|CAI79209.1|  705|Caenorhabditis elegans Hypothetical pr...    30   1.9  
Z83235-8|CAB05774.2|  894|Caenorhabditis elegans Hypothetical pr...    30   1.9  
Z66513-12|CAI46602.1|  492|Caenorhabditis elegans Hypothetical p...    29   2.5  
Z66513-11|CAA91332.3|  427|Caenorhabditis elegans Hypothetical p...    29   2.5  
AL008869-2|CAC42315.1|  810|Caenorhabditis elegans Hypothetical ...    29   2.5  
AL008869-1|CAA15516.1|  808|Caenorhabditis elegans Hypothetical ...    29   2.5  
AB032749-1|BAA92158.1|  810|Caenorhabditis elegans EAT-20B protein.    29   2.5  
AB032748-1|BAA92157.1|  808|Caenorhabditis elegans EAT-20A protein.    29   2.5  
Z78200-2|CAB01578.1|  588|Caenorhabditis elegans Hypothetical pr...    29   3.3  
Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z48585-4|CAA88480.1|  476|Caenorhabditis elegans Hypothetical pr...    28   7.6  

>U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation factor
           protein 4, isoforma protein.
          Length = 463

 Score =  275 bits (674), Expect = 2e-74
 Identities = 136/166 (81%), Positives = 140/166 (84%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA TLGVKQLIV  NKMDSTEPP+SE RF EI  E
Sbjct: 128 SKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNE 173



 Score =  110 bits (265), Expect = 8e-25
 Identities = 48/64 (75%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S +IKKIGYNP AV FVPISG++GDNMLE S+ MPWFKGW VERKEG A GK L+EALD+
Sbjct: 175 SGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDS 234

Query: 690 ILPP 701
           I+PP
Sbjct: 235 IIPP 238


>U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation factor
           protein 3 protein.
          Length = 463

 Score =  275 bits (674), Expect = 2e-74
 Identities = 136/166 (81%), Positives = 140/166 (84%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA TLGVKQLIV  NKMDSTEPP+SE RF EI  E
Sbjct: 128 SKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNE 173



 Score =  110 bits (265), Expect = 8e-25
 Identities = 48/64 (75%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S +IKKIGYNP AV FVPISG++GDNMLE S+ MPWFKGW VERKEG A GK L+EALD+
Sbjct: 175 SGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDS 234

Query: 690 ILPP 701
           I+PP
Sbjct: 235 IIPP 238


>U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation factor
           protein 4, isoformc protein.
          Length = 267

 Score =  265 bits (650), Expect = 2e-71
 Identities = 148/230 (64%), Positives = 155/230 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGI
Sbjct: 68  ERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLL 549
           SKNGQTREHALLA TLGVKQL+       S   P             P +SRR  T Q L
Sbjct: 128 SKNGQTREHALLAQTLGVKQLV-------SLRSP----------TRSPDSSRRSDTIQRL 170

Query: 550 SLSCPFLDGTETTCWSLQPKCLGSRDGRWSVRKAKLTENASLKLSMPSCH 699
                  D TETTC      C GSRDG  + RK  L E  S +L  PS H
Sbjct: 171 FHLSQSPDSTETTCLRSPRTCHGSRDGLLNARKETLPERPSSRLLTPSSH 220


>U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation factor
           protein 4, isoformd protein.
          Length = 429

 Score =  181 bits (441), Expect(2) = 3e-52
 Identities = 89/110 (80%), Positives = 92/110 (83%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVA 339
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVL+VA
Sbjct: 68  ERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVA 117



 Score =  110 bits (265), Expect = 8e-25
 Identities = 48/64 (75%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S +IKKIGYNP AV FVPISG++GDNMLE S+ MPWFKGW VERKEG A GK L+EALD+
Sbjct: 141 SGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDS 200

Query: 690 ILPP 701
           I+PP
Sbjct: 201 IIPP 204



 Score = 41.9 bits (94), Expect(2) = 3e-52
 Identities = 18/26 (69%), Positives = 20/26 (76%)
 Frame = +1

Query: 430 LIVGVNKMDSTEPPYSEPRFEEIKKE 507
           L+V  NKMDSTEPP+SE RF EI  E
Sbjct: 114 LVVACNKMDSTEPPFSEARFTEITNE 139


>Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical
           protein K07A12.4b protein.
          Length = 592

 Score =  180 bits (439), Expect = 7e-46
 Identities = 91/166 (54%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ + ER
Sbjct: 171 INLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDETEEER 230

Query: 190 ERRYHNRY--CSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           ER         S E  + +++   +DAPGH+DFI NMITGTSQAD A+L+V A TGEFE 
Sbjct: 231 ERGVTMDIGRTSFETSHRRIVL--LDAPGHKDFISNMITGTSQADAAILVVNATTGEFET 288

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
           G    GQT+EHALL  +LGV QLIV VNK+D+ +  +S+ RF+EIK
Sbjct: 289 GFENGGQTKEHALLLRSLGVTQLIVAVNKLDTVD--WSQDRFDEIK 332


>Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical
           protein K07A12.4a protein.
          Length = 610

 Score =  180 bits (439), Expect = 7e-46
 Identities = 91/166 (54%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ + ER
Sbjct: 189 INLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDETEEER 248

Query: 190 ERRYHNRY--CSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           ER         S E  + +++   +DAPGH+DFI NMITGTSQAD A+L+V A TGEFE 
Sbjct: 249 ERGVTMDIGRTSFETSHRRIVL--LDAPGHKDFISNMITGTSQADAAILVVNATTGEFET 306

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
           G    GQT+EHALL  +LGV QLIV VNK+D+ +  +S+ RF+EIK
Sbjct: 307 GFENGGQTKEHALLLRSLGVTQLIVAVNKLDTVD--WSQDRFDEIK 350


>Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical
           protein H19N07.1 protein.
          Length = 532

 Score =  161 bits (390), Expect = 6e-40
 Identities = 85/199 (42%), Positives = 121/199 (60%), Gaps = 7/199 (3%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  IN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E G+ S+  +W +D   
Sbjct: 107 KEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMDTND 166

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ERE+         Y   E R+  +L    DAPGH+ F+ NMI G +QAD AVL+++A  
Sbjct: 167 EEREKGKTVEVGRAYFETEKRHFTIL----DAPGHKSFVPNMIVGANQADLAVLVISARR 222

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRR 528
           GEFE G  + GQTREH++L  T GVK L++ VNKMD     + E RF+EI+ +     R+
Sbjct: 223 GEFETGFDRGGQTREHSMLVKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRK 282

Query: 529 LA---TTQLLSLSCPFLDG 576
           L     T +  + C  L G
Sbjct: 283 LGFNPKTDITYVPCSGLTG 301



 Score = 28.3 bits (60), Expect = 5.8
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 2/68 (2%)
 Frame = +3

Query: 501 EGR-SSYIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLI 674
           EG+ + +++K+G+NP   + +VP SG  G  + +  T       W          G C I
Sbjct: 273 EGKLTPFLRKLGFNPKTDITYVPCSGLTGAFIKDRPTGSEG--NWY--------SGPCFI 322

Query: 675 EALDAILP 698
           E +D +LP
Sbjct: 323 EFIDVLLP 330


>U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation factor
           protein 4, isoformb protein.
          Length = 77

 Score =  125 bits (301), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 58/60 (96%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK  +
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKVTK 67


>U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 2 protein.
          Length = 439

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 55/154 (35%), Positives = 76/154 (49%), Gaps = 2/154 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHL--IYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           +N+  IGH+D GK+T T  +  +    G  K    KF++               +DK K 
Sbjct: 46  VNVGTIGHIDHGKTTLTSAITRVQAKKGFAKHI--KFDE---------------IDKGKE 88

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           E++R        +   +      H D PGH DFIKNMI GTSQ D AVL++AA  G  E 
Sbjct: 89  EKKRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME- 147

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
                 QT+EH +LA  +GVK + + +NK D  E
Sbjct: 148 ------QTKEHLILAKQVGVKNMAIFINKADLVE 175


>AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial
           elongation factorTu homologue protein.
          Length = 439

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 55/154 (35%), Positives = 76/154 (49%), Gaps = 2/154 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHL--IYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           +N+  IGH+D GK+T T  +  +    G  K    KF++               +DK K 
Sbjct: 46  VNVGTIGHIDHGKTTLTSAITRVQAKKGFAKHI--KFDE---------------IDKGKE 88

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           E++R        +   +      H D PGH DFIKNMI GTSQ D AVL++AA  G  E 
Sbjct: 89  EKKRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME- 147

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
                 QT+EH +LA  +GVK + + +NK D  E
Sbjct: 148 ------QTKEHLILAKQVGVKNMAIFINKADLVE 175


>D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 495

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 59/164 (35%), Positives = 81/164 (49%), Gaps = 5/164 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ L+   
Sbjct: 50  LNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYET 109

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           A+R       Y             HID PGH D+IKNMITG +Q + A+L+VAA  G   
Sbjct: 110 AKRH------YA------------HIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP 151

Query: 361 AGISKNGQTREHALLAFTLGV--KQLIVGVNKMDSTEPPYSEPR 486
                  QTREH LLA  +GV    ++V +NK+D  E P +E R
Sbjct: 152 -------QTREHLLLARQVGVPLDNIVVFMNKVD--EVPDAETR 186


>D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 496

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 59/164 (35%), Positives = 81/164 (49%), Gaps = 5/164 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ L+   
Sbjct: 51  LNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYET 110

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           A+R       Y             HID PGH D+IKNMITG +Q + A+L+VAA  G   
Sbjct: 111 AKRH------YA------------HIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP 152

Query: 361 AGISKNGQTREHALLAFTLGV--KQLIVGVNKMDSTEPPYSEPR 486
                  QTREH LLA  +GV    ++V +NK+D  E P +E R
Sbjct: 153 -------QTREHLLLARQVGVPLDNIVVFMNKVD--EVPDAETR 187


>AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 1 protein.
          Length = 496

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 59/164 (35%), Positives = 81/164 (49%), Gaps = 5/164 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ L+   
Sbjct: 51  LNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYET 110

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           A+R       Y             HID PGH D+IKNMITG +Q + A+L+VAA  G   
Sbjct: 111 AKRH------YA------------HIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP 152

Query: 361 AGISKNGQTREHALLAFTLGV--KQLIVGVNKMDSTEPPYSEPR 486
                  QTREH LLA  +GV    ++V +NK+D  E P +E R
Sbjct: 153 -------QTREHLLLARQVGVPLDNIVVFMNKVD--EVPDAETR 187


>L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical
           protein ZK1236.1 protein.
          Length = 645

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 45/148 (30%), Positives = 66/148 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GKST    L+  CG +        +K+             +LDKL+ ERE
Sbjct: 44  NFGIVAHVDHGKSTLADRLLEMCGAVPPG-----QKQ-------------MLDKLQVERE 85

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R    +  +  +R+   L   ID PGH DF   +    +  D  +L+VAA  G       
Sbjct: 86  RGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQG------- 138

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QT  +  LAF   + Q+I  +NK+D
Sbjct: 139 VQAQTIANFWLAFEKNI-QIIPVINKID 165


>Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical
           protein C47B2.7b protein.
          Length = 500

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 25/83 (30%), Positives = 42/83 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH   I+ ++  ++  D A++I+     +  AGI    QT EH LLA      ++I
Sbjct: 77  IDCPGHSGLIRAVLAASTVFDMAIVII-----DVVAGIQP--QTAEHLLLASKFCPNRVI 129

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           + +NK D  E        ++++K
Sbjct: 130 IVLNKCDLAEKSKISESAKKVRK 152


>Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical
           protein F29C12.4 protein.
          Length = 750

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 42/148 (28%), Positives = 60/148 (40%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  ++Y  G ID            E+ +G       +D +  ER+
Sbjct: 46  NIGISAHIDSGKTTVTERILYYAGRIDSM---------HEV-RGKDDVGATMDFMDLERQ 95

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R    +  +  V         ID PGH DF   +       D AVL++  G G    G+ 
Sbjct: 96  RGITIQSAATYVDWHGTNINIIDTPGHVDFTVEVERALRVLDGAVLVL-CGVG----GVQ 150

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
               T    L  + +     I  VNKMD
Sbjct: 151 SQTFTVNRQLARYNV---PFICFVNKMD 175


>AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical
           protein Y119D3B.14 protein.
          Length = 689

 Score = 36.7 bits (81), Expect = 0.016
 Identities = 35/113 (30%), Positives = 48/113 (42%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI VI HVD+GK+T T  L+Y  G I           A  + KG+     V D L  ERE
Sbjct: 27  NIGVIAHVDAGKTTVTERLLYLAGAI---------HVAGHVDKGN----TVTDFLDIERE 73

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  ++ +         ID PGH DF   +       D  V+++    G
Sbjct: 74  RGITVQSAAVNLDWKGHRINLIDTPGHVDFRVEVERCVRVLDGIVVVIDGSAG 126


>Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical
           protein F46B6.6a protein.
          Length = 702

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 26/67 (38%), Positives = 31/67 (46%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G   AD  VL+VAA  G  E       QT +    A    V QL+
Sbjct: 209 LDTPGHAAFASMRARGAKGADIVVLVVAADDGVKE-------QTAQSIKFAKDANV-QLV 260

Query: 436 VGVNKMD 456
           V VNK+D
Sbjct: 261 VAVNKID 267


>M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation factor
           protein.
          Length = 852

 Score = 35.9 bits (79), Expect = 0.029
 Identities = 38/127 (29%), Positives = 58/127 (45%), Gaps = 14/127 (11%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQE----MGKGSFKYAWV 165
           N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE    +   +    + 
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFE 80

Query: 166 LDKLKAERERRYHNRYCSLEVRN*Q-----VLCYHIDAPGHRDFIKNMITGTSQADCAVL 330
           L+K   E  +   N++ ++EV   +      L   ID+PGH DF   +       D A++
Sbjct: 81  LEKKDLEFVKG-ENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALGVTDGALV 139

Query: 331 IVAAGTG 351
           +V   +G
Sbjct: 140 VVDCVSG 146


>Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical
           protein F25H5.4 protein.
          Length = 852

 Score = 35.5 bits (78), Expect = 0.038
 Identities = 38/127 (29%), Positives = 58/127 (45%), Gaps = 14/127 (11%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQE----MGKGSFKYAWV 165
           N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE    +   +    + 
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFE 80

Query: 166 LDKLKAERERRYHNRYCSLEVRN*Q-----VLCYHIDAPGHRDFIKNMITGTSQADCAVL 330
           L+K   E  +   N++ ++EV   +      L   ID+PGH DF   +       D A++
Sbjct: 81  LEKKDLEFVKG-ENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALV 139

Query: 331 IVAAGTG 351
           +V   +G
Sbjct: 140 VVDCVSG 146


>AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical
           protein Y39G10AR.8 protein.
          Length = 469

 Score = 34.7 bits (76), Expect = 0.066
 Identities = 21/81 (25%), Positives = 35/81 (43%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A L+VA              QT EH      + +  L+
Sbjct: 132 VDCPGHDILMATMLNGAAVMDAAFLLVAGNEP------CPQPQTSEHLAAVEIMQLNHLM 185

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
           +  NK+D  +   +   +E+I
Sbjct: 186 ILQNKVDIIKESQARENYEQI 206


>AC024817-55|AAF59563.3|  366|Caenorhabditis elegans Hypothetical
           protein Y54G2A.28 protein.
          Length = 366

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = -1

Query: 449 LFTPTMSCLTPRVKASKACSRV*PFLEIPASNSPVPAATMSTA 321
           LF PT+SC+  +  AS   S   P +  PA N  VP AT+S +
Sbjct: 13  LFDPTLSCMATQNSASATLSCANPTVAAPA-NDDVPEATLSVS 54


>DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic
           translation initiationfactor eIF5B protein.
          Length = 1074

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 3/89 (3%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F      G+S  D A+L+V     +   G+    QT E +L     G    +
Sbjct: 554 IDTPGHESFSNLRTRGSSLCDFAILVV-----DIMHGLEP--QTIE-SLKLLIKGKTPFV 605

Query: 436 VGVNKMDSTEPPYSEPR---FEEIKKEDP 513
           + +NK+D      S PR   +E +K + P
Sbjct: 606 IALNKIDRLYEYESNPRKDVYELLKSQKP 634


>Z83235-9|CAI79209.1|  705|Caenorhabditis elegans Hypothetical
           protein K10C3.5b protein.
          Length = 705

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 26/111 (23%), Positives = 47/111 (42%)
 Frame = +1

Query: 4   HEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           H  N+ ++ HVD GK++    L+     I  R              G  +Y   +D  + 
Sbjct: 19  HIRNVCLVAHVDHGKTSFADSLVSANAVISSRM------------AGKLRY---MDSRED 63

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
           E+ R    +   + +    +L   ID+PGH DF   + +    +D A+L++
Sbjct: 64  EQTRGITMKSSGISLLCEPLLINLIDSPGHVDFSGEVTSALILSDIALLLI 114


>Z83235-8|CAB05774.2|  894|Caenorhabditis elegans Hypothetical
           protein K10C3.5a protein.
          Length = 894

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 26/111 (23%), Positives = 47/111 (42%)
 Frame = +1

Query: 4   HEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           H  N+ ++ HVD GK++    L+     I  R              G  +Y   +D  + 
Sbjct: 19  HIRNVCLVAHVDHGKTSFADSLVSANAVISSRM------------AGKLRY---MDSRED 63

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
           E+ R    +   + +    +L   ID+PGH DF   + +    +D A+L++
Sbjct: 64  EQTRGITMKSSGISLLCEPLLINLIDSPGHVDFSGEVTSALILSDIALLLI 114


>Z66513-12|CAI46602.1|  492|Caenorhabditis elegans Hypothetical
           protein F54D5.5b protein.
          Length = 492

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 91  DKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           +KR ++  EKE  +     F Y   LDK+K ER+
Sbjct: 272 EKRKLKDMEKECNDAKNAMFHYMNQLDKVKKERD 305


>Z66513-11|CAA91332.3|  427|Caenorhabditis elegans Hypothetical
           protein F54D5.5a protein.
          Length = 427

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 91  DKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           +KR ++  EKE  +     F Y   LDK+K ER+
Sbjct: 207 EKRKLKDMEKECNDAKNAMFHYMNQLDKVKKERD 240


>AL008869-2|CAC42315.1|  810|Caenorhabditis elegans Hypothetical
           protein H30A04.1b protein.
          Length = 810

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +1

Query: 511 PHTSRRLATTQLLSLSCPFLD 573
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AL008869-1|CAA15516.1|  808|Caenorhabditis elegans Hypothetical
           protein H30A04.1a protein.
          Length = 808

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +1

Query: 511 PHTSRRLATTQLLSLSCPFLD 573
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AB032749-1|BAA92158.1|  810|Caenorhabditis elegans EAT-20B protein.
          Length = 810

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +1

Query: 511 PHTSRRLATTQLLSLSCPFLD 573
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AB032748-1|BAA92157.1|  808|Caenorhabditis elegans EAT-20A protein.
          Length = 808

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +1

Query: 511 PHTSRRLATTQLLSLSCPFLD 573
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>Z78200-2|CAB01578.1|  588|Caenorhabditis elegans Hypothetical
           protein T04H1.2 protein.
          Length = 588

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 44/156 (28%), Positives = 61/156 (39%), Gaps = 6/156 (3%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKC----GGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 174
           E+ + V+G  D GKST  G L   C     G  +  I +F  E +  GK S     V+  
Sbjct: 168 EVRLAVVGGCDVGKSTLCGVLTQGCLDDGNGKARIGIFRFPHEVR-TGKTSSVCNDVIGF 226

Query: 175 LKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTS--QADCAVLIVAAGT 348
               +   Y        V     L   ID  G   + K  I G +      A L+VAA  
Sbjct: 227 DNRGKLVNYAQNSLEEMVEKSSKLVTLIDLAGDAKYQKTTIHGLTGYTPHFACLVVAA-- 284

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
              + GI+    TREH  L   L +   ++ + KMD
Sbjct: 285 ---DRGIT--WATREHLGLIAALNIPMFVL-ITKMD 314


>Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical
          protein C47B2.7a protein.
          Length = 459

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 10/17 (58%), Positives = 15/17 (88%)
 Frame = +1

Query: 10 INIVVIGHVDSGKSTTT 60
          +N+ ++GHVDSGK+T T
Sbjct: 14 LNLGILGHVDSGKTTLT 30


>Z48585-4|CAA88480.1|  476|Caenorhabditis elegans Hypothetical
           protein ZK673.4 protein.
          Length = 476

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = +1

Query: 478 EPRFEEIKKEDPHTSRRLATTQLLSLSCPF 567
           EP FEE   E P TS  +AT    + + PF
Sbjct: 353 EPEFEEHFDEQPSTSSYMATATATATATPF 382


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,383,549
Number of Sequences: 27780
Number of extensions: 381424
Number of successful extensions: 1212
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1105
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1191
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1666201324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -