SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF039720-12|AAB96704.1|  399|Caenorhabditis elegans Hypothetical...   128   4e-30
AC024844-2|AAK29954.2|  399|Caenorhabditis elegans Hypothetical ...   128   4e-30
Z12116-1|CAA78102.1|  402|Caenorhabditis elegans protein ( C.ele...   123   1e-28
U13876-3|AAA21170.1|  402|Caenorhabditis elegans Initiation fact...   123   1e-28
U13876-4|AAX88826.1|  115|Caenorhabditis elegans Initiation fact...    87   9e-18
U13876-12|AAA21169.1|  363|Caenorhabditis elegans Hypothetical p...    85   6e-17
Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical pr...    68   8e-12
Z50071-2|CAA90406.1|  638|Caenorhabditis elegans Hypothetical pr...    68   8e-12
Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical pr...    68   8e-12
AC006605-1|AAK85443.1|  430|Caenorhabditis elegans Conserved ger...    51   9e-07
Z81555-7|CAB04518.1|  561|Caenorhabditis elegans Hypothetical pr...    47   1e-05
Z54327-6|CAA91120.1|  425|Caenorhabditis elegans Hypothetical pr...    46   2e-05
U08102-1|AAB65852.1|  417|Caenorhabditis elegans putative RNA he...    46   2e-05
AC024859-14|AAY43989.1|  643|Caenorhabditis elegans Hypothetical...    45   6e-05
U62772-1|AAB04136.1|  763|Caenorhabditis elegans RNA helicase pr...    43   2e-04
U60449-1|AAB03510.1|  974|Caenorhabditis elegans GLH-2 protein.        43   2e-04
U60194-1|AAB03337.1|  974|Caenorhabditis elegans RNA helicase GL...    43   2e-04
AF000197-1|AAB52901.2|  763|Caenorhabditis elegans Germ-line hel...    43   2e-04
AC006625-11|AAK68269.1|  974|Caenorhabditis elegans Germ-line he...    43   2e-04
L19948-1|AAC27384.1|  763|Caenorhabditis elegans RNA helicase pr...    43   3e-04
Z75546-3|CAA99891.1|  581|Caenorhabditis elegans Hypothetical pr...    42   3e-04
AC024830-10|AAF59610.3|  728|Caenorhabditis elegans Hypothetical...    41   0.001
U13070-1|AAK67224.1|  730|Caenorhabditis elegans Hypothetical pr...    39   0.003
AF079509-1|AAC28388.1|  720|Caenorhabditis elegans germline RNA ...    39   0.003
AF003145-4|AAB57719.1|  720|Caenorhabditis elegans Germ-line hel...    39   0.003
Z81449-4|CAB03765.1|  811|Caenorhabditis elegans Hypothetical pr...    38   0.007
Z29115-1|CAA82362.1|  489|Caenorhabditis elegans Hypothetical pr...    37   0.012
AF045641-1|AAK68386.1|  970|Caenorhabditis elegans Hypothetical ...    37   0.012
AC024810-3|AAU20831.1|  660|Caenorhabditis elegans Vasa- and bel...    36   0.022
AC024810-2|AAK68520.1|  644|Caenorhabditis elegans Vasa- and bel...    36   0.022
AC024810-1|AAF60764.1|  641|Caenorhabditis elegans Vasa- and bel...    36   0.022
AL034488-3|CAA22456.1|  504|Caenorhabditis elegans Hypothetical ...    35   0.066
L17337-1|AAP68928.1|  593|Caenorhabditis elegans Hypothetical pr...    34   0.088
AC024876-4|AAU05555.1|  825|Caenorhabditis elegans Hypothetical ...    34   0.088
AC024876-3|AAU05556.1|  871|Caenorhabditis elegans Hypothetical ...    34   0.088
AF025451-4|AAL16306.1|  567|Caenorhabditis elegans Hypothetical ...    33   0.20 
AF025451-3|AAB71200.2|  634|Caenorhabditis elegans Hypothetical ...    33   0.20 
AC025726-23|AAK73934.1|  763|Caenorhabditis elegans Hypothetical...    32   0.35 
AC006665-5|AAF39907.1|  630|Caenorhabditis elegans Hypothetical ...    31   0.62 
EU051652-1|ABS85191.1|  973|Caenorhabditis elegans MEL-46 protein.     31   0.82 
CU457744-1|CAM36366.2|  973|Caenorhabditis elegans Hypothetical ...    31   0.82 
Z81147-8|CAB03537.1|  338|Caenorhabditis elegans Hypothetical pr...    31   1.1  
Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical pr...    31   1.1  
AC006661-5|AAF39890.2|  488|Caenorhabditis elegans Hypothetical ...    30   1.4  
AC006661-4|ABB88208.1|  561|Caenorhabditis elegans Hypothetical ...    30   1.4  
L14331-9|AAA28101.2| 1845|Caenorhabditis elegans Dicer related p...    29   3.3  
Z22177-1|CAA80151.1|  578|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z46240-2|CAA86311.1|  213|Caenorhabditis elegans Hypothetical pr...    28   5.8  
AF039039-1|AAB94180.2|  653|Caenorhabditis elegans Hypothetical ...    28   5.8  
U80447-2|AAO38637.1|  579|Caenorhabditis elegans Hypothetical pr...    28   7.6  
U80447-1|AAB37806.1|  746|Caenorhabditis elegans Hypothetical pr...    28   7.6  

>AF039720-12|AAB96704.1|  399|Caenorhabditis elegans Hypothetical
           protein F33D11.10 protein.
          Length = 399

 Score =  128 bits (309), Expect = 4e-30
 Identities = 52/85 (61%), Positives = 73/85 (85%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A++ EEWK +TL DLYDTL+I QAV+FCNTRRKVDWLT+ M   +FTVS+MHGDM+
Sbjct: 241 QFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDME 300

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q++R+ +M++FR G++RVLI+T  W
Sbjct: 301 QKDRDEVMKEFRAGTTRVLISTDVW 325



 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 36/74 (48%), Positives = 45/74 (60%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS VINYDLP+NRE Y                 NFV + D R L+DIE +Y 
Sbjct: 326 ARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYS 385

Query: 442 TSIVEMPSDVANLI 483
           T I EMP ++A++I
Sbjct: 386 TQIDEMPMNIADII 399


>AC024844-2|AAK29954.2|  399|Caenorhabditis elegans Hypothetical
           protein Y65B4A.6 protein.
          Length = 399

 Score =  128 bits (309), Expect = 4e-30
 Identities = 52/85 (61%), Positives = 73/85 (85%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A++ EEWK +TL DLYDTL+I QAV+FCNTRRKVDWLT+ M   +FTVS+MHGDM+
Sbjct: 241 QFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDME 300

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q++R+ +M++FR G++RVLI+T  W
Sbjct: 301 QKDRDEVMKEFRAGTTRVLISTDVW 325



 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 36/74 (48%), Positives = 45/74 (60%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS VINYDLP+NRE Y                 NFV + D R L+DIE +Y 
Sbjct: 326 ARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYS 385

Query: 442 TSIVEMPSDVANLI 483
           T I EMP ++A++I
Sbjct: 386 TQIDEMPMNIADII 399


>Z12116-1|CAA78102.1|  402|Caenorhabditis elegans protein (
           C.elegans mRNA for eIF-4A homologue. ).
          Length = 402

 Score =  123 bits (296), Expect = 1e-28
 Identities = 54/82 (65%), Positives = 67/82 (81%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI ++ +EWK + LCDLY+ +++ QAVIFCNTRRKVD LTE M    FTVS +HGDMD
Sbjct: 244 QFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMD 303

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER+ IMR+FR+GSSRVLITT
Sbjct: 304 QAERDTIMREFRSGSSRVLITT 325



 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 44/76 (57%), Positives = 49/76 (64%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +LARGIDVQQVS VINYDLPSNRENY                 NFVTE D R LK+IE +
Sbjct: 327 ILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESY 386

Query: 436 YHTSIVEMPSDVANLI 483
           Y T I EMP  +A+LI
Sbjct: 387 YTTQIEEMPESIADLI 402


>U13876-3|AAA21170.1|  402|Caenorhabditis elegans Initiation factor
           protein 1, isoforma protein.
          Length = 402

 Score =  123 bits (296), Expect = 1e-28
 Identities = 54/82 (65%), Positives = 67/82 (81%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI ++ +EWK + LCDLY+ +++ QAVIFCNTRRKVD LTE M    FTVS +HGDMD
Sbjct: 244 QFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMD 303

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER+ IMR+FR+GSSRVLITT
Sbjct: 304 QAERDTIMREFRSGSSRVLITT 325



 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 44/76 (57%), Positives = 49/76 (64%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +LARGIDVQQVS VINYDLPSNRENY                 NFVTE D R LK+IE +
Sbjct: 327 ILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESY 386

Query: 436 YHTSIVEMPSDVANLI 483
           Y T I EMP  +A+LI
Sbjct: 387 YTTQIEEMPESIADLI 402


>U13876-4|AAX88826.1|  115|Caenorhabditis elegans Initiation factor
           protein 1, isoformb protein.
          Length = 115

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 44/76 (57%), Positives = 49/76 (64%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +LARGIDVQQVS VINYDLPSNRENY                 NFVTE D R LK+IE +
Sbjct: 40  ILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESY 99

Query: 436 YHTSIVEMPSDVANLI 483
           Y T I EMP  +A+LI
Sbjct: 100 YTTQIEEMPESIADLI 115



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 26/33 (78%), Positives = 30/33 (90%)
 Frame = +2

Query: 155 FTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           FTVS +HGDMDQ ER+ IMR+FR+GSSRVLITT
Sbjct: 6   FTVSCLHGDMDQAERDTIMREFRSGSSRVLITT 38


>U13876-12|AAA21169.1|  363|Caenorhabditis elegans Hypothetical
           protein F57B9.3 protein.
          Length = 363

 Score = 84.6 bits (200), Expect = 6e-17
 Identities = 38/82 (46%), Positives = 54/82 (65%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI ++ +EWK   LCDL  T    QA+IFCNTRR+V  LTE +      VS  HG+M+
Sbjct: 203 QFYINVQKDEWKFNCLCDLLKTSRETQALIFCNTRRRVTQLTEQLMSIPIKVSCFHGNME 262

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             ERE +++ F + ++RVL+TT
Sbjct: 263 HNEREDMVKDFNSRNTRVLVTT 284



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 27/69 (39%), Positives = 37/69 (53%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L+ARG+++++ S +INYD+  N ENY                 +F TE D   LK IE+ 
Sbjct: 286 LMARGMNIRK-SLIINYDVSGNMENYMLRNGRQGNFGSKGLPISFFTENDISDLKKIENH 344

Query: 436 YHTSIVEMP 462
           Y T I EMP
Sbjct: 345 YSTRIEEMP 353


>Z50071-3|CAA90407.1|  613|Caenorhabditis elegans Hypothetical
           protein T07D4.4c protein.
          Length = 613

 Score = 67.7 bits (158), Expect = 8e-12
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+     + K   + +LY  L++A +VIFC+T+  V WL E+M  R   V  +HGDM 
Sbjct: 431 QFYVQCACRDSKYAAIVNLYSGLAVASSVIFCHTKASVMWLYENMRARGHQVDVLHGDMT 490

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             ER   +  F+ G  +VLITT
Sbjct: 491 VVERADTIIHFKRGDFKVLITT 512



 Score = 35.9 bits (79), Expect = 0.029
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           + ARGIDV QVS VINYDLP
Sbjct: 514 VFARGIDVAQVSVVINYDLP 533


>Z50071-2|CAA90406.1|  638|Caenorhabditis elegans Hypothetical
           protein T07D4.4b protein.
          Length = 638

 Score = 67.7 bits (158), Expect = 8e-12
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+     + K   + +LY  L++A +VIFC+T+  V WL E+M  R   V  +HGDM 
Sbjct: 456 QFYVQCACRDSKYAAIVNLYSGLAVASSVIFCHTKASVMWLYENMRARGHQVDVLHGDMT 515

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             ER   +  F+ G  +VLITT
Sbjct: 516 VVERADTIIHFKRGDFKVLITT 537



 Score = 35.9 bits (79), Expect = 0.029
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           + ARGIDV QVS VINYDLP
Sbjct: 539 VFARGIDVAQVSVVINYDLP 558


>Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical protein
            T07D4.4a protein.
          Length = 1022

 Score = 67.7 bits (158), Expect = 8e-12
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +2

Query: 8    RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
            +FY+     + K   + +LY  L++A +VIFC+T+  V WL E+M  R   V  +HGDM 
Sbjct: 840  QFYVQCACRDSKYAAIVNLYSGLAVASSVIFCHTKASVMWLYENMRARGHQVDVLHGDMT 899

Query: 188  QREREVIMRQFRTGSSRVLITT 253
              ER   +  F+ G  +VLITT
Sbjct: 900  VVERADTIIHFKRGDFKVLITT 921



 Score = 35.9 bits (79), Expect = 0.029
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           + ARGIDV QVS VINYDLP
Sbjct: 923 VFARGIDVAQVSVVINYDLP 942


>AC006605-1|AAK85443.1|  430|Caenorhabditis elegans Conserved
           germline helicase protein1 protein.
          Length = 430

 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 27/72 (37%), Positives = 33/72 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LL RGID+Q V+ VIN+D P N E Y                 N +T  DR  L+ IE  
Sbjct: 339 LLTRGIDIQAVNVVINFDFPRNAETYLHRIGRSGRFGHLGVAINLITYEDRHTLRRIEQE 398

Query: 436 YHTSIVEMPSDV 471
             T I  +P  V
Sbjct: 399 LRTRIEPIPKTV 410



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           G   Y A   E+ K+  L  L+  L I Q++IFCN+ ++V+ L + +    ++   +H  
Sbjct: 254 GVTQYYAFVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYSCYYIHSK 313

Query: 182 MDQREREVIMRQFRTGSSRVLI 247
           M Q  R  +   FR G+ R L+
Sbjct: 314 MAQNHRNRVFHDFRQGNCRNLV 335


>Z81555-7|CAB04518.1|  561|Caenorhabditis elegans Hypothetical
           protein F58E10.3a protein.
          Length = 561

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 18/56 (32%), Positives = 35/56 (62%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+RK D LT +M    +    +HGD +Q ER+ ++++F+ G + +++ T
Sbjct: 378 KTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLAT 433



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+DV  +  VINYD P+N E+Y                  F T  +    KD+
Sbjct: 437 ARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDL 491


>Z54327-6|CAA91120.1|  425|Caenorhabditis elegans Hypothetical
           protein C26D10.2a protein.
          Length = 425

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 3/81 (3%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + ++Y                  FV+ E D + L  ++D
Sbjct: 342 LFGRGMDIERVNIVFNYDMPEDSDSYLHRVARAGRFGTKGLAITFVSDENDAKTLNSVQD 401

Query: 433 FYHTSIVEMPS--DVANLI*G 489
            +  SI E+P   DV+  I G
Sbjct: 402 RFDISITELPEKIDVSTYIEG 422



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           Y+ ++  E K   L +L D L   Q VIF    ++ + L + +  ++F   A+H  M Q 
Sbjct: 262 YVKLKEAE-KNRRLLNLLDALEFNQVVIFVKAVKRCEALHQLLTEQNFPSIAIHRQMAQE 320

Query: 194 EREVIMRQFRTGSSRVLITT 253
           ER    + F+    R+L+ T
Sbjct: 321 ERLSRYQAFKDFQKRILVAT 340


>U08102-1|AAB65852.1|  417|Caenorhabditis elegans putative RNA
           helicase protein.
          Length = 417

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 3/81 (3%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + ++Y                  FV+ E D + L  ++D
Sbjct: 334 LFGRGMDIERVNIVFNYDMPEDSDSYLHRVARAGRFGTKGLAITFVSDENDAKTLNSVQD 393

Query: 433 FYHTSIVEMPS--DVANLI*G 489
            +  SI E+P   DV+  I G
Sbjct: 394 RFDISITELPEKIDVSTYIEG 414



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           Y+ ++  E K   L +L D L   Q VIF    ++ + L + +  ++F   A+H  M Q 
Sbjct: 254 YVKLKEAE-KNRRLLNLLDALEFNQVVIFVKAVKRCEALHQLLTEQNFPSIAIHRQMAQE 312

Query: 194 EREVIMRQFRTGSSRVLITT 253
           ER    + F+    R+L+ T
Sbjct: 313 ERLSRYQAFKDFQKRILVAT 332


>AC024859-14|AAY43989.1|  643|Caenorhabditis elegans Hypothetical
           protein Y71H2AM.19 protein.
          Length = 643

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E+ K   L DL D T   +  ++F  T+R    L   ++ +++ V  +HGD+ Q ERE  
Sbjct: 410 EDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKH 469

Query: 209 MRQFRTGSSRVLITT 253
           +  FRTG++ +L+ T
Sbjct: 470 LDLFRTGTAPILVAT 484



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VINYDLPS+ + Y                 +F  + +R   +++ D   
Sbjct: 488 ARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKNRNIARELMDLIV 547

Query: 442 TSIVEMP 462
            +  E+P
Sbjct: 548 EANQELP 554


>U62772-1|AAB04136.1|  763|Caenorhabditis elegans RNA helicase
           protein.
          Length = 763

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           + I+++ +  E   ++Y      + ++F + R   D L   +         +HG  +QRE
Sbjct: 589 LGIDIDSYTTEKSAEVYTK----KTMVFVSQRAMADTLASILSSAQVPAITIHGAREQRE 644

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   +RQFR GS  VLI T
Sbjct: 645 RSEALRQFRNGSKPVLIAT 663



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENY 333
           RG+D++ V  VINYD+P N ++Y
Sbjct: 668 RGLDIKGVDHVINYDMPDNIDDY 690


>U60449-1|AAB03510.1|  974|Caenorhabditis elegans GLH-2 protein.
          Length = 974

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +2

Query: 17   IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
            + I+++ +  E   ++Y      + ++F + R   D L   +         +HG  +QRE
Sbjct: 800  LGIDIDSYTTEKNSEVYTK----KTIVFVSQRAMADTLASILSSAQVPAITIHGAREQRE 855

Query: 197  REVIMRQFRTGSSRVLITT 253
            R   +RQFR GS  VLI T
Sbjct: 856  RSEALRQFRNGSKPVLIAT 874



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENY 333
           RG+D++ V  VINYD+P N ++Y
Sbjct: 879 RGLDIKGVDHVINYDMPDNIDDY 901


>U60194-1|AAB03337.1|  974|Caenorhabditis elegans RNA helicase GLH-2
            protein.
          Length = 974

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +2

Query: 17   IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
            + I+++ +  E   ++Y      + ++F + R   D L   +         +HG  +QRE
Sbjct: 800  LGIDIDSYTTEKNSEVYTK----KTIVFVSQRAMADTLASILSSAQVPAITIHGAREQRE 855

Query: 197  REVIMRQFRTGSSRVLITT 253
            R   +RQFR GS  VLI T
Sbjct: 856  RSEALRQFRNGSKPVLIAT 874



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENY 333
           RG+D++ V  VINYD+P N ++Y
Sbjct: 879 RGLDIKGVDHVINYDMPDNIDDY 901


>AF000197-1|AAB52901.2|  763|Caenorhabditis elegans Germ-line
           helicase protein 1 protein.
          Length = 763

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           + I+++ +  E   ++Y      + ++F + R   D L   +         +HG  +QRE
Sbjct: 589 LGIDIDSYTTEKSAEVYTK----KTMVFVSQRAMADTLASILSSAQVPAITIHGAREQRE 644

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   +RQFR GS  VLI T
Sbjct: 645 RSEALRQFRNGSKPVLIAT 663



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENY 333
           RG+D++ V  VINYD+P N ++Y
Sbjct: 668 RGLDIKGVDHVINYDMPDNIDDY 690


>AC006625-11|AAK68269.1|  974|Caenorhabditis elegans Germ-line
            helicase protein 2 protein.
          Length = 974

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +2

Query: 17   IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
            + I+++ +  E   ++Y      + ++F + R   D L   +         +HG  +QRE
Sbjct: 800  LGIDIDSYTTEKNSEVYTK----KTIVFVSQRAMADTLASILSSAQVPAITIHGAREQRE 855

Query: 197  REVIMRQFRTGSSRVLITT 253
            R   +RQFR GS  VLI T
Sbjct: 856  RSEALRQFRNGSKPVLIAT 874



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENY 333
           RG+D++ V  VINYD+P N ++Y
Sbjct: 879 RGLDIKGVDHVINYDMPDNIDDY 901


>L19948-1|AAC27384.1|  763|Caenorhabditis elegans RNA helicase
           protein.
          Length = 763

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           + I+++ +  E   ++Y      + ++F + R   D L   +         +HG  +QRE
Sbjct: 589 LGIDIDSYTTEKSAEVYTK----KTMVFVSQRAMADILASILSSAQVPAITIHGAREQRE 644

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   +RQFR GS  VLI T
Sbjct: 645 RSEALRQFRNGSKPVLIAT 663



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENY 333
           RG+D++ V  VINYD+P N ++Y
Sbjct: 668 RGLDIKGVDHVINYDMPDNIDDY 690


>Z75546-3|CAA99891.1|  581|Caenorhabditis elegans Hypothetical
           protein R05D11.4 protein.
          Length = 581

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 23/79 (29%), Positives = 36/79 (45%)
 Frame = +1

Query: 226 WLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEAD 405
           W+  C +   LL RG+D+  V  VINYDLP++  +Y                  + T+AD
Sbjct: 427 WVLVCTE---LLGRGLDLSDVGLVINYDLPTSIVSYIHRVGRTGRAGKSGHAVTYFTDAD 483

Query: 406 RRALKDIEDFYHTSIVEMP 462
            + +K I      S  ++P
Sbjct: 484 MKYIKSIATVIRQSGFDVP 502


>AC024830-10|AAF59610.3|  728|Caenorhabditis elegans Hypothetical
           protein Y55F3BR.1 protein.
          Length = 728

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 15/58 (25%), Positives = 32/58 (55%)
 Frame = +2

Query: 74  LSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLI 247
           L + +A++FC T+++ D +   +   + + + +HGD    ER+  +  F+ G  R L+
Sbjct: 503 LQMDKAIVFCRTKQQCDHMEHFLQQNNLSAACLHGDRSAEERQSSLEGFKKGIIRFLV 560


>U13070-1|AAK67224.1|  730|Caenorhabditis elegans Hypothetical
           protein F01F1.7 protein.
          Length = 730

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 18/74 (24%), Positives = 39/74 (52%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E+ K + L ++ ++      +IF N ++  D L++ +    F  + +HG   Q +RE  +
Sbjct: 557 EDRKRKKLVEVLESQFQPPIIIFVNQKKGADMLSKGLTKLGFKPTVLHGGKGQDQREYAL 616

Query: 212 RQFRTGSSRVLITT 253
           +  + G+S +L+ T
Sbjct: 617 QALKEGTSDILVAT 630



 Score = 35.5 bits (78), Expect = 0.038
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED-FYH 441
           RGIDV+ VS V+NYD+  + E+Y                  F+T  D     D++     
Sbjct: 635 RGIDVKDVSLVLNYDMAKSIEDYTHRIGRTGRAGKHGKAITFLTPDDTAVYFDLKQVLVE 694

Query: 442 TSIVEMPSDVAN 477
           + +   P ++AN
Sbjct: 695 SPVSSCPPELAN 706


>AF079509-1|AAC28388.1|  720|Caenorhabditis elegans germline RNA
           helicase-3 protein.
          Length = 720

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/79 (24%), Positives = 39/79 (49%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           + I+++ +  E   D++    + + ++F   ++  D L   M         +HG  +Q+E
Sbjct: 546 LGIDIDTYTTEKNSDVF----VKKTIVFVAQQKMADTLASIMSAAQVPAITIHGAREQKE 601

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   ++ FR+G+  VLI T
Sbjct: 602 RSAALKLFRSGAKPVLIAT 620



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEAD 405
           ++ RG+D++ V  VINYD+P+N ++Y                 +F++ AD
Sbjct: 622 VVERGLDIKGVDHVINYDMPNNIDDYIHRIGRTGRVGNSGRATSFISLAD 671


>AF003145-4|AAB57719.1|  720|Caenorhabditis elegans Germ-line
           helicase protein 3 protein.
          Length = 720

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/79 (24%), Positives = 39/79 (49%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           + I+++ +  E   D++    + + ++F   ++  D L   M         +HG  +Q+E
Sbjct: 546 LGIDIDTYTTEKNSDVF----VKKTIVFVAQQKMADTLASIMSAAQVPAITIHGAREQKE 601

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   ++ FR+G+  VLI T
Sbjct: 602 RSAALKLFRSGAKPVLIAT 620



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEAD 405
           ++ RG+D++ V  VINYD+P+N ++Y                 +F++ AD
Sbjct: 622 VVERGLDIKGVDHVINYDMPNNIDDYIHRIGRTGRVGNSGRATSFISLAD 671


>Z81449-4|CAB03765.1|  811|Caenorhabditis elegans Hypothetical
           protein C46F11.4 protein.
          Length = 811

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 18/65 (27%), Positives = 37/65 (56%)
 Frame = +2

Query: 59  DLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSR 238
           +L +  S+ + +IF   +   + + + + ++DF +  +HGDM Q ER   + +FR   S+
Sbjct: 504 NLVEFASLGKVLIFVTKKLDSEDVAKKLKMKDFDIVLLHGDMLQAERNENLLKFRK-KSQ 562

Query: 239 VLITT 253
           +L+ T
Sbjct: 563 ILVAT 567


>Z29115-1|CAA82362.1|  489|Caenorhabditis elegans Hypothetical
           protein T26G10.1 protein.
          Length = 489

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+D+  V  VINYD+PS  ++Y                   VT+ D  A + IE
Sbjct: 344 ARGLDIPHVDMVINYDMPSQSKDYVHRVGRTARAGRSGIAITVVTQYDVEAYQKIE 399


>AF045641-1|AAK68386.1|  970|Caenorhabditis elegans Hypothetical
           protein F53H1.1 protein.
          Length = 970

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 15/56 (26%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDF-TVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +++F + + K D + + +    + +V+ +HG +DQ +R+  +  F+TG  +VL+ T
Sbjct: 554 SIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKTGVIKVLVAT 609



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+ +  V+NYD P++ E+Y
Sbjct: 613 ARGLDVKNLILVVNYDCPNHYEDY 636


>AC024810-3|AAU20831.1|  660|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform c protein.
          Length = 660

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VINYDLP + + Y                 +F  + +R   +D+++   
Sbjct: 459 ARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIV 518

Query: 442 TSIVEMP 462
            S  E+P
Sbjct: 519 ESNQEVP 525



 Score = 35.5 bits (78), Expect = 0.038
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  + L   ++ +     ++HGD+ Q ERE  +  FR+G   +L+ T
Sbjct: 402 LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVAT 455


>AC024810-2|AAK68520.1|  644|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform b protein.
          Length = 644

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VINYDLP + + Y                 +F  + +R   +D+++   
Sbjct: 443 ARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIV 502

Query: 442 TSIVEMP 462
            S  E+P
Sbjct: 503 ESNQEVP 509



 Score = 35.5 bits (78), Expect = 0.038
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  + L   ++ +     ++HGD+ Q ERE  +  FR+G   +L+ T
Sbjct: 386 LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVAT 439


>AC024810-1|AAF60764.1|  641|Caenorhabditis elegans Vasa- and
           belle-like helicase protein1, isoform a protein.
          Length = 641

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VINYDLP + + Y                 +F  + +R   +D+++   
Sbjct: 440 ARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIV 499

Query: 442 TSIVEMP 462
            S  E+P
Sbjct: 500 ESNQEVP 506



 Score = 35.5 bits (78), Expect = 0.038
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  + L   ++ +     ++HGD+ Q ERE  +  FR+G   +L+ T
Sbjct: 383 LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVAT 436


>AL034488-3|CAA22456.1|  504|Caenorhabditis elegans Hypothetical
           protein Y54G11A.3 protein.
          Length = 504

 Score = 34.7 bits (76), Expect = 0.066
 Identities = 16/72 (22%), Positives = 35/72 (48%), Gaps = 5/72 (6%)
 Frame = +2

Query: 53  LCDLYDTLSIAQA-----VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           +C++ + L+ A       +IF  ++   D L+    ++      +HG   Q +RE+ +  
Sbjct: 324 VCEIVNFLTAAHGQNYKMIIFVKSKVMADHLSSDFCMKGINSQGLHGGRSQSDREMSLNM 383

Query: 218 FRTGSSRVLITT 253
            R+G  ++L+ T
Sbjct: 384 LRSGEVQILVAT 395



 Score = 33.1 bits (72), Expect = 0.20
 Identities = 19/72 (26%), Positives = 30/72 (41%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L +RGIDV  ++ V+NYD P + E Y                 +F+   DR   + +   
Sbjct: 397 LASRGIDVPDITHVLNYDFPMDIEEYVHRVGRTGRAGRKGEAMSFLWWNDRSNFEGLIQI 456

Query: 436 YHTSIVEMPSDV 471
              S  E+P  +
Sbjct: 457 LEKSEQEVPDQL 468


>L17337-1|AAP68928.1|  593|Caenorhabditis elegans Hypothetical
           protein ZK686.2 protein.
          Length = 593

 Score = 34.3 bits (75), Expect = 0.088
 Identities = 13/22 (59%), Positives = 19/22 (86%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSN 321
           +LARG D+ +V CVINY+LP++
Sbjct: 458 VLARGTDLNKVDCVINYNLPAD 479


>AC024876-4|AAU05555.1|  825|Caenorhabditis elegans Hypothetical
           protein Y94H6A.5a protein.
          Length = 825

 Score = 34.3 bits (75), Expect = 0.088
 Identities = 13/56 (23%), Positives = 30/56 (53%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q V+FC T + V+++   +H      S ++  +D   R++ +++F    + +L+ T
Sbjct: 267 QTVVFCATMKHVEYVVGILHRAGIDCSFVYSQLDATARKMNIQKFHEKQNNILVVT 322


>AC024876-3|AAU05556.1|  871|Caenorhabditis elegans Hypothetical
           protein Y94H6A.5b protein.
          Length = 871

 Score = 34.3 bits (75), Expect = 0.088
 Identities = 13/56 (23%), Positives = 30/56 (53%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q V+FC T + V+++   +H      S ++  +D   R++ +++F    + +L+ T
Sbjct: 267 QTVVFCATMKHVEYVVGILHRAGIDCSFVYSQLDATARKMNIQKFHEKQNNILVVT 322


>AF025451-4|AAL16306.1|  567|Caenorhabditis elegans Hypothetical
           protein C24H12.4b protein.
          Length = 567

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 18/66 (27%), Positives = 29/66 (43%)
 Frame = +1

Query: 235 SCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRA 414
           S LD    ++RGID   VS V+N+D P   + Y                 +F   ++R  
Sbjct: 360 SKLDKESGVSRGIDFHHVSNVVNFDFPETTDAYIHRVGRTARGFNKGTALSFCIPSERAH 419

Query: 415 LKDIED 432
           L+ I++
Sbjct: 420 LEQIQE 425


>AF025451-3|AAB71200.2|  634|Caenorhabditis elegans Hypothetical
           protein C24H12.4a protein.
          Length = 634

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 18/66 (27%), Positives = 29/66 (43%)
 Frame = +1

Query: 235 SCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRA 414
           S LD    ++RGID   VS V+N+D P   + Y                 +F   ++R  
Sbjct: 427 SKLDKESGVSRGIDFHHVSNVVNFDFPETTDAYIHRVGRTARGFNKGTALSFCIPSERAH 486

Query: 415 LKDIED 432
           L+ I++
Sbjct: 487 LEQIQE 492


>AC025726-23|AAK73934.1|  763|Caenorhabditis elegans Hypothetical
           protein Y71G12B.8 protein.
          Length = 763

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 16/57 (28%), Positives = 28/57 (49%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           L +RG+D++ V  VIN ++P + + Y                 + V E +R+ LK+I
Sbjct: 476 LASRGLDIEGVQTVINMNMPKSIKQYIHRVGRTARAGKAGRSISLVGEDERKLLKEI 532


>AC006665-5|AAF39907.1|  630|Caenorhabditis elegans Hypothetical
           protein H27M09.1 protein.
          Length = 630

 Score = 31.5 bits (68), Expect = 0.62
 Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIEDFY 438
           ++G+D Q +  VIN+D+P + ENY                  F+  +++   L D++   
Sbjct: 502 SKGLDFQGIEHVINFDMPEDIENYVHRIGRTGRSGRKGLATTFINKKSEMSVLSDLKQLL 561

Query: 439 HTSIVEMP 462
             +  E+P
Sbjct: 562 AEAGQELP 569


>EU051652-1|ABS85191.1|  973|Caenorhabditis elegans MEL-46 protein.
          Length = 973

 Score = 31.1 bits (67), Expect = 0.82
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L ARGID   V+ V+N D  +N E Y
Sbjct: 318 LTARGIDADNVNLVVNIDAAANEETY 343


>CU457744-1|CAM36366.2|  973|Caenorhabditis elegans Hypothetical
           protein T06A10.1 protein.
          Length = 973

 Score = 31.1 bits (67), Expect = 0.82
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L ARGID   V+ V+N D  +N E Y
Sbjct: 318 LTARGIDADNVNLVVNIDAAANEETY 343


>Z81147-8|CAB03537.1|  338|Caenorhabditis elegans Hypothetical
           protein T09E11.10 protein.
          Length = 338

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 12/38 (31%), Positives = 23/38 (60%)
 Frame = +2

Query: 104 NTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           N  RK  W+T+   ++   V  + GD+DQ+ +E++M +
Sbjct: 96  NVLRKT-WMTQRNRIKSIFVIGLGGDVDQKTKELVMSE 132


>Z81094-7|CAB03153.2|  960|Caenorhabditis elegans Hypothetical
           protein F58G11.2 protein.
          Length = 960

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           LL+RGIDV  +  VIN+DLP
Sbjct: 705 LLSRGIDVSDLDRVINFDLP 724



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 13/56 (23%), Positives = 25/56 (44%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF   + + D     +         +HGD  Q  RE ++  F++    +L+TT
Sbjct: 648 KTIIFVQKKDQCDACAAKLTSGGMLAQTLHGDRSQDMREKLINDFKSNRVNLLVTT 703


>AC006661-5|AAF39890.2|  488|Caenorhabditis elegans Hypothetical
           protein H20J04.4a protein.
          Length = 488

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/66 (22%), Positives = 29/66 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+++P   + Y                 +FVT+ D   L+ +E    
Sbjct: 398 SRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIG 457

Query: 442 TSIVEM 459
             + E+
Sbjct: 458 KKLDEL 463


>AC006661-4|ABB88208.1|  561|Caenorhabditis elegans Hypothetical
           protein H20J04.4b protein.
          Length = 561

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/66 (22%), Positives = 29/66 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+++P   + Y                 +FVT+ D   L+ +E    
Sbjct: 398 SRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIG 457

Query: 442 TSIVEM 459
             + E+
Sbjct: 458 KKLDEL 463


>L14331-9|AAA28101.2| 1845|Caenorhabditis elegans Dicer related
           protein 1 protein.
          Length = 1845

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +1

Query: 235 SCLDHHCLLARGIDVQQVSCVINYDLPSNRENY 333
           +CL    +L  G+DV+Q + VI +D P +  +Y
Sbjct: 455 NCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSY 487


>Z22177-1|CAA80151.1|  578|Caenorhabditis elegans Hypothetical
           protein ZK512.2 protein.
          Length = 578

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSN 321
           ++ARGID+  +  VI +DLP +
Sbjct: 318 VMARGIDISDIDWVIQFDLPKH 339


>Z46240-2|CAA86311.1|  213|Caenorhabditis elegans Hypothetical
           protein B0272.2 protein.
          Length = 213

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +2

Query: 110 RRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           R +VD L   +H  D  VSA+H  M QR R    R
Sbjct: 68  RMRVDQLRADVHRVDMAVSAVHTRMTQRWRAATER 102


>AF039039-1|AAB94180.2|  653|Caenorhabditis elegans Hypothetical
           protein T08B1.6 protein.
          Length = 653

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTES 139
           KLETLCD+ D   +   +IFC   ++ +    S
Sbjct: 134 KLETLCDIIDNCKL--EIIFCENAKRAEGFLSS 164


>U80447-2|AAO38637.1|  579|Caenorhabditis elegans Hypothetical
           protein F55F8.2b protein.
          Length = 579

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+Q +  VI+Y +P   E Y
Sbjct: 334 ARGLDIQGIDHVIHYQVPKKVEIY 357


>U80447-1|AAB37806.1|  746|Caenorhabditis elegans Hypothetical
           protein F55F8.2a protein.
          Length = 746

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+Q +  VI+Y +P   E Y
Sbjct: 501 ARGLDIQGIDHVIHYQVPKKVEIY 524


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,908,548
Number of Sequences: 27780
Number of extensions: 327924
Number of successful extensions: 789
Number of sequences better than 10.0: 51
Number of HSP's better than 10.0 without gapping: 727
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 784
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1666201324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -