SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20027
         (779 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U46675-7|AAB52641.1| 1274|Caenorhabditis elegans Hypothetical pr...    35   0.075
AC024877-12|AAF60902.1|  128|Caenorhabditis elegans Hypothetical...    32   0.40 
Z77662-15|CAI79240.1|  255|Caenorhabditis elegans Hypothetical p...    31   0.70 
U23181-6|AAC48204.1|  801|Caenorhabditis elegans Hypothetical pr...    31   0.70 
Z77136-8|CAB00885.2|  278|Caenorhabditis elegans Hypothetical pr...    31   1.2  
AF125969-1|AAD14762.2| 1484|Caenorhabditis elegans Hypothetical ...    31   1.2  
Z73102-6|CAA97412.1|  522|Caenorhabditis elegans Hypothetical pr...    30   1.6  
AY818713-1|AAX35669.1|  691|Caenorhabditis elegans LIN-65S protein.    30   1.6  
AY818712-1|AAX35668.1|  728|Caenorhabditis elegans LIN-65L protein.    30   1.6  
AF047661-4|AAC04435.2|  931|Caenorhabditis elegans Hypothetical ...    30   1.6  
AC025726-22|AAN73851.2|  512|Caenorhabditis elegans Abnormal cel...    30   1.6  
AC025726-21|AAK73935.3|  728|Caenorhabditis elegans Abnormal cel...    30   1.6  
AF016674-4|AAB66130.1|  287|Caenorhabditis elegans Hypothetical ...    30   2.1  
AC006645-9|AAF39841.2|  293|Caenorhabditis elegans Nematode asta...    30   2.1  
U41992-7|AAA83358.1|  374|Caenorhabditis elegans Hypothetical pr...    29   2.8  
U21310-2|AAA62521.1|  322|Caenorhabditis elegans T box family pr...    29   2.8  
AC024807-1|AAF59529.5|  704|Caenorhabditis elegans Hypothetical ...    29   2.8  
Z99279-6|CAB16498.1|  640|Caenorhabditis elegans Hypothetical pr...    29   3.7  
Z82284-8|CAB05294.1|  640|Caenorhabditis elegans Hypothetical pr...    29   3.7  
U56966-4|AAA98719.2|  906|Caenorhabditis elegans Ace(angiotensin...    29   3.7  
U56966-3|AAU05584.1|  332|Caenorhabditis elegans Ace(angiotensin...    29   3.7  
AF078790-10|AAC26931.1|  197|Caenorhabditis elegans Hypothetical...    29   3.7  
Z96102-2|CAI79216.1|  746|Caenorhabditis elegans Hypothetical pr...    29   4.9  
Z50874-10|CAA90770.1|  302|Caenorhabditis elegans Hypothetical p...    29   4.9  
AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily a...    29   4.9  
L10986-3|AAA28018.1|  650|Caenorhabditis elegans Abnormal cell m...    28   8.6  
L10986-2|AAK84523.2|  667|Caenorhabditis elegans Abnormal cell m...    28   8.6  
L10986-1|AAR25648.1|  779|Caenorhabditis elegans Abnormal cell m...    28   8.6  

>U46675-7|AAB52641.1| 1274|Caenorhabditis elegans Hypothetical
           protein F35A5.1 protein.
          Length = 1274

 Score = 34.7 bits (76), Expect = 0.075
 Identities = 23/87 (26%), Positives = 37/87 (42%), Gaps = 4/87 (4%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADS----AAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADA 673
           +  +  ++ P+  D+E +AD     ++  P + KK  + P   S   A+P    P+    
Sbjct: 695 KTPVLAKKAPTKPDSEAAADPVSGPSSKDPKLAKKAPVKPRDPSPMKAVPIKPAPKTEVP 754

Query: 674 PKLADNPVDEDKPADISPDAPKAEAKS 754
           P +   P    K  D SP   KAE  S
Sbjct: 755 PAVVKKPEPVAKSRDPSPKKAKAEPNS 781


>AC024877-12|AAF60902.1|  128|Caenorhabditis elegans Hypothetical
           protein Y95B8A.2 protein.
          Length = 128

 Score = 32.3 bits (70), Expect = 0.40
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +2

Query: 650 KTPEAADAPKLADNPVDEDKPADISPDAPKAEAKSA 757
           K   AA  P+ A  P +ED   DI   APKA+A++A
Sbjct: 71  KPAPAAAGPRSAPAPTNEDYNTDIDVPAPKAKARAA 106


>Z77662-15|CAI79240.1|  255|Caenorhabditis elegans Hypothetical
           protein F47B8.14 protein.
          Length = 255

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 19/50 (38%), Positives = 23/50 (46%)
 Frame = +2

Query: 608 APTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAEAKSA 757
           AP   ++ A+ P    PEAA AP+    P  E  PA     AP A A  A
Sbjct: 101 APAAPAEPASAPA-PAPEAAPAPEPTPAPAPEAAPAPAPDAAPTAPAAGA 149


>U23181-6|AAC48204.1|  801|Caenorhabditis elegans Hypothetical
           protein ZK84.1 protein.
          Length = 801

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = +2

Query: 542 TDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAP-KLADNPVDEDKPAD 718
           TD+  SAD+ A + +       A + E+ A  I   +T  A   P  +AD     D P+ 
Sbjct: 334 TDSAASADTTAALVDTSSSEHAAESTEAPATDIAATETTPAPSVPAPVADAAAGYDSPSS 393

Query: 719 ISPDAPKAEAK 751
           I  + P   A+
Sbjct: 394 IPEETPAPAAE 404



 Score = 27.9 bits (59), Expect = 8.6
 Identities = 26/81 (32%), Positives = 35/81 (43%), Gaps = 4/81 (4%)
 Frame = +2

Query: 527 EKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADA-PKLADN--PV 697
           + PS+   E  A +A   P        A    + A A  E   PE A A P  A    P 
Sbjct: 389 DSPSSIPEETPAPAAEDTPAPASAA--AEETPAPAPAAEETPAPETASAAPDAAGGAAPA 446

Query: 698 DEDKPADISPDAPK-AEAKSA 757
           D   PAD++  AP+ + A+SA
Sbjct: 447 DVAAPADVATTAPETSSAQSA 467


>Z77136-8|CAB00885.2|  278|Caenorhabditis elegans Hypothetical
           protein ZC376.8 protein.
          Length = 278

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 1/59 (1%)
 Frame = +2

Query: 581 PNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVD-EDKPADISPDAPKAEAKS 754
           P   K +  AP+ ES     P  K PE   AP  AD     E+K  +  P+ P    KS
Sbjct: 37  PKKKKDVSGAPSAESPPPPPPAPKVPEPPKAPPPADAVKKIEEKGEEKKPEEPAKSKKS 95


>AF125969-1|AAD14762.2| 1484|Caenorhabditis elegans Hypothetical
            protein Y38C9A.1 protein.
          Length = 1484

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +2

Query: 536  SATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAP-KLADNPVDEDKP 712
            +A   +  A S++I PN    I  AP+    +AA P+I  P A  AP   +    D+D+ 
Sbjct: 1062 TAPTVQAPAPSSSI-PNTSTSIPKAPSAPVLSAAPPKIVAPAAPAAPTHYSPISSDDDEI 1120

Query: 713  ADISPDAPKAEAKSA 757
              I P   K  A SA
Sbjct: 1121 QCIEPPPAKKPAPSA 1135


>Z73102-6|CAA97412.1|  522|Caenorhabditis elegans Hypothetical
           protein B0035.5 protein.
          Length = 522

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
 Frame = +2

Query: 527 EKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADN-PVDE 703
           EKP++ +AE   D    +    K ++L   V     A PE   PEA+   K   + P D 
Sbjct: 280 EKPASLNAEDIRDEKVKVLKAAKVVELKDVVVGQYIASPEFDHPEASQGYKDDKSVPADS 339

Query: 704 DKP 712
             P
Sbjct: 340 TTP 342


>AY818713-1|AAX35669.1|  691|Caenorhabditis elegans LIN-65S protein.
          Length = 691

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 5/90 (5%)
 Frame = +2

Query: 512 EISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADN 691
           ++ ++E  +    E   + AA  P        AP  E+  A+ P+ + PE  D P  +  
Sbjct: 31  DMDEDEDVTTDGPESQEELAADAPAPGAPEASAPAQEASEASAPDQEAPEVQDVPDSSGA 90

Query: 692 P---VDEDKPADIS-PDAP-KAEAKSADDL 766
           P       + +D S P+ P   EA+ A D+
Sbjct: 91  PDASAQASEASDASAPEVPGSTEAQDAQDV 120


>AY818712-1|AAX35668.1|  728|Caenorhabditis elegans LIN-65L protein.
          Length = 728

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 5/90 (5%)
 Frame = +2

Query: 512 EISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADN 691
           ++ ++E  +    E   + AA  P        AP  E+  A+ P+ + PE  D P  +  
Sbjct: 68  DMDEDEDVTTDGPESQEELAADAPAPGAPEASAPAQEASEASAPDQEAPEVQDVPDSSGA 127

Query: 692 P---VDEDKPADIS-PDAP-KAEAKSADDL 766
           P       + +D S P+ P   EA+ A D+
Sbjct: 128 PDASAQASEASDASAPEVPGSTEAQDAQDV 157


>AF047661-4|AAC04435.2|  931|Caenorhabditis elegans Hypothetical
           protein M70.1 protein.
          Length = 931

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/51 (27%), Positives = 22/51 (43%)
 Frame = +2

Query: 593 KKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAE 745
           KK D  P+       +P   TP+ A  P     P  ++KP D++    + E
Sbjct: 812 KKKDTKPSAPKPKPDVPVNPTPQTAKVPVAPAPPAKDEKPKDVNVKKAETE 862


>AC025726-22|AAN73851.2|  512|Caenorhabditis elegans Abnormal cell
           lineage protein 65,isoform b protein.
          Length = 512

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 5/90 (5%)
 Frame = +2

Query: 512 EISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADN 691
           ++ ++E  +    E   + AA  P        AP  E+  A+ P+ + PE  D P  +  
Sbjct: 68  DMDEDEDVTTDGPESQEELAADAPAPGAPEASAPAQEASEASAPDQEAPEVQDVPDSSGA 127

Query: 692 P---VDEDKPADIS-PDAP-KAEAKSADDL 766
           P       + +D S P+ P   EA+ A D+
Sbjct: 128 PDASAQASEASDASAPEVPGSTEAQDAQDV 157


>AC025726-21|AAK73935.3|  728|Caenorhabditis elegans Abnormal cell
           lineage protein 65,isoform a protein.
          Length = 728

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 5/90 (5%)
 Frame = +2

Query: 512 EISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADN 691
           ++ ++E  +    E   + AA  P        AP  E+  A+ P+ + PE  D P  +  
Sbjct: 68  DMDEDEDVTTDGPESQEELAADAPAPGAPEASAPAQEASEASAPDQEAPEVQDVPDSSGA 127

Query: 692 P---VDEDKPADIS-PDAP-KAEAKSADDL 766
           P       + +D S P+ P   EA+ A D+
Sbjct: 128 PDASAQASEASDASAPEVPGSTEAQDAQDV 157


>AF016674-4|AAB66130.1|  287|Caenorhabditis elegans Hypothetical
           protein C03H5.3 protein.
          Length = 287

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 3/87 (3%)
 Frame = +2

Query: 485 KN*STSYRAEISKEEKPS-ATDAEGSADSAAIIPNMVKKIDLAPT--VESDAAAIPEIKT 655
           KN   +  AEI++E K   A   E S D  A    +   +   P+   + D   +PE   
Sbjct: 61  KNSGENSSAEIAEEHKEIVAPSQENSVDDDAESTQLSVDVFADPSDFEDDDDEVVPETDY 120

Query: 656 PEAADAPKLADNPVDEDKPADISPDAP 736
            +  + PK   NPV+    +D   D P
Sbjct: 121 EDNNEEPKNDQNPVEIPDNSDSDDDEP 147


>AC006645-9|AAF39841.2|  293|Caenorhabditis elegans Nematode astacin
           protease protein 2 protein.
          Length = 293

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 199 VAPKIDDSVKPTEVAAATERRKPNL-LQLVTTRYPLYQRPK 318
           VAPK+ +  K  E+A +T+R K    ++L+ T+ P ++  K
Sbjct: 15  VAPKVLEPEKDDEIAVSTQREKTFFDMKLILTKLPTFEPSK 55


>U41992-7|AAA83358.1|  374|Caenorhabditis elegans Hypothetical
           protein F32E10.6 protein.
          Length = 374

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/79 (26%), Positives = 32/79 (40%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPV 697
           SK  K +A+D +   +  A   +   K    P  E D      +KTP+     K A+ P 
Sbjct: 218 SKSTKRAASDDDEEEEPVATKKSKKSKRAETPEEEDDEEE-EVVKTPKKTKKSKRAETPE 276

Query: 698 DEDKPADISPDAPKAEAKS 754
           +ED+  +     PK    S
Sbjct: 277 EEDEVEEEVVKTPKKSKSS 295



 Score = 27.9 bits (59), Expect = 8.6
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 9/87 (10%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAII--PNMVKKIDLAPTVESDAAAIPEI-KTPE---AADAPK 679
           SK+ K + T  E   +   ++  P   KK   A T E +     E+ KTP+   ++ +PK
Sbjct: 240 SKKSKRAETPEEEDDEEEEVVKTPKKTKKSKRAETPEEEDEVEEEVVKTPKKSKSSKSPK 299

Query: 680 L---ADNPVDEDKPADISPDAPKAEAK 751
               A+   +ED+  +   +APK+  K
Sbjct: 300 KSKRAETSDEEDEDEEDEKEAPKSSKK 326


>U21310-2|AAA62521.1|  322|Caenorhabditis elegans T box family
           protein 11 protein.
          Length = 322

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKI-DLAPTVESDAAAIPEIKTPEAAD 670
           ST  R +  + E+ S   +EG++   +I P   KKI D+AP +  D + I +    ++  
Sbjct: 180 STGSRKD-RRRERQSPVYSEGTSSEKSISPPPAKKIKDMAPAL-PDYSVISKPNLLQSLI 237

Query: 671 APKLADNPVDEDKP 712
            P +A+ P     P
Sbjct: 238 FPMIAEQPSTSQSP 251


>AC024807-1|AAF59529.5|  704|Caenorhabditis elegans Hypothetical
           protein Y53G8AL.1 protein.
          Length = 704

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +2

Query: 590 VKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPD 730
           V  +DL  T E+    IPEI TP   D+ +  +N V+  + ++I  D
Sbjct: 289 VPSLDLEETTENPE--IPEISTPREEDSAENLENLVENSEKSEILED 333


>Z99279-6|CAB16498.1|  640|Caenorhabditis elegans Hypothetical
           protein Y57G11A.2 protein.
          Length = 640

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 10/27 (37%), Positives = 16/27 (59%)
 Frame = +3

Query: 270 PAPVSNDEVPAIPEAKKDDIAPEDSDI 350
           P P   +E+P +PE  ++   P DS+I
Sbjct: 536 PGPAVTEEIPEVPEPTEEPPTPTDSEI 562


>Z82284-8|CAB05294.1|  640|Caenorhabditis elegans Hypothetical
           protein Y57G11A.2 protein.
          Length = 640

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 10/27 (37%), Positives = 16/27 (59%)
 Frame = +3

Query: 270 PAPVSNDEVPAIPEAKKDDIAPEDSDI 350
           P P   +E+P +PE  ++   P DS+I
Sbjct: 536 PGPAVTEEIPEVPEPTEEPPTPTDSEI 562


>U56966-4|AAA98719.2|  906|Caenorhabditis elegans Ace(angiotensin
           converting enzyme)-like non-peptidase protein 1, isoform
           a protein.
          Length = 906

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 21/82 (25%), Positives = 28/82 (34%), Gaps = 1/82 (1%)
 Frame = +3

Query: 276 PVSNDEVPAIPEAKKDDIAPEDSDIAXXXXXXXXXXXXXXXXAKSS-EIPDAEAKSADIK 452
           PV   E+   PE    D AP+D +                     S  +P+ E K     
Sbjct: 16  PVFTQEIKPKPELLPADEAPKDPEAVFSEGEPFELTDALDTPKNGSVPVPEPEPKPEPEP 75

Query: 453 VEEPAAQPEDSKTEVQATVLKF 518
             EP  +PE S T      +KF
Sbjct: 76  EPEPKPEPEPSPTPEPEPAIKF 97


>U56966-3|AAU05584.1|  332|Caenorhabditis elegans Ace(angiotensin
           converting enzyme)-like non-peptidase protein 1, isoform
           b protein.
          Length = 332

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 21/82 (25%), Positives = 28/82 (34%), Gaps = 1/82 (1%)
 Frame = +3

Query: 276 PVSNDEVPAIPEAKKDDIAPEDSDIAXXXXXXXXXXXXXXXXAKSS-EIPDAEAKSADIK 452
           PV   E+   PE    D AP+D +                     S  +P+ E K     
Sbjct: 16  PVFTQEIKPKPELLPADEAPKDPEAVFSEGEPFELTDALDTPKNGSVPVPEPEPKPEPEP 75

Query: 453 VEEPAAQPEDSKTEVQATVLKF 518
             EP  +PE S T      +KF
Sbjct: 76  EPEPKPEPEPSPTPEPEPAIKF 97


>AF078790-10|AAC26931.1|  197|Caenorhabditis elegans Hypothetical
           protein F36H12.5 protein.
          Length = 197

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 3/67 (4%)
 Frame = +2

Query: 572 AIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDED---KPADISPDAPKA 742
           A  PN +  I     V   A+  P    PEA   P+  + P  E    K     PDAPK 
Sbjct: 33  AAAPNPISSISSNSKVAPPASPPPP---PEAEKKPETGEEPKKEKSKMKSEVKEPDAPKK 89

Query: 743 EAKSADD 763
           + K++D+
Sbjct: 90  DDKTSDE 96


>Z96102-2|CAI79216.1|  746|Caenorhabditis elegans Hypothetical
           protein H39E23.3 protein.
          Length = 746

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTP--EAADAPK 679
           +A   +E  P  T+   SADS    P  VK+    P  ES   A  E K P    AD PK
Sbjct: 504 KAPAKREADPPKTE---SADSEKKAP--VKREADKPKTES---ADSEKKAPAKREADPPK 555

Query: 680 LADNPVDEDKPADISPDAPKAEAKSAD 760
                 +++ PA    D PK E+  ++
Sbjct: 556 TESADSEKNAPAKREADKPKTESADSE 582



 Score = 28.7 bits (61), Expect = 4.9
 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTP--EAADAPK 679
           +A   +E  P  T+   SADS    P  VK+    P  ES   A  E K P    AD PK
Sbjct: 624 KAPAKREADPPKTE---SADSEKKAP--VKREADKPKTES---ADSEKKAPAKREADPPK 675

Query: 680 LADNPVDEDKPADISPDAPKAEAKSAD 760
                 +++ PA    D PK E+  ++
Sbjct: 676 TESADSEKNAPAKREADKPKTESADSE 702



 Score = 28.3 bits (60), Expect = 6.5
 Identities = 23/68 (33%), Positives = 31/68 (45%)
 Frame = +2

Query: 557 SADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAP 736
           SADS    P  VK+    P  ES   A  E K P   ++ K      D +K A +  +A 
Sbjct: 238 SADSEKKAP--VKREADKPKTES---ADSEKKAPAKRESDKPKTESADSEKKAPVKREAD 292

Query: 737 KAEAKSAD 760
           K + +SAD
Sbjct: 293 KPKTESAD 300



 Score = 28.3 bits (60), Expect = 6.5
 Identities = 23/68 (33%), Positives = 31/68 (45%)
 Frame = +2

Query: 557 SADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAP 736
           SADS    P  VK+    P  ES   A  E K P   ++ K      D +K A +  +A 
Sbjct: 278 SADSEKKAP--VKREADKPKTES---ADSEKKAPAKRESDKPKTESADSEKKAPVKREAD 332

Query: 737 KAEAKSAD 760
           K + +SAD
Sbjct: 333 KPKTESAD 340



 Score = 28.3 bits (60), Expect = 6.5
 Identities = 25/85 (29%), Positives = 37/85 (43%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLA 685
           +A + +E     T+   SADS    P  VK+    P  ES A +  +  T   AD PK  
Sbjct: 404 KAPVKREADKPKTE---SADSEKKAP--VKREADPPKTES-ADSEKKAPTKREADPPKTE 457

Query: 686 DNPVDEDKPADISPDAPKAEAKSAD 760
               ++  PA    D PK E+  ++
Sbjct: 458 SADSEKKAPAKREADPPKTESADSE 482



 Score = 27.9 bits (59), Expect = 8.6
 Identities = 24/85 (28%), Positives = 37/85 (43%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLA 685
           +A + +E     T+   SADS    P   ++ D   T  +D+    E K P   +A K  
Sbjct: 324 KAPVKREADKPKTE---SADSEKKAPTK-READPPKTESADS----EKKAPAKREADKPK 375

Query: 686 DNPVDEDKPADISPDAPKAEAKSAD 760
               D +K A    +A K + +SAD
Sbjct: 376 TESADSEKKASAKREADKPKTESAD 400



 Score = 27.9 bits (59), Expect = 8.6
 Identities = 26/85 (30%), Positives = 36/85 (42%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLA 685
           +A   +E  P  T+   SADS    P   K+    P  ES   A  E K P   +A    
Sbjct: 464 KAPAKREADPPKTE---SADSEKKAP--AKREADPPKTES---ADSEKKAPAKREADPPK 515

Query: 686 DNPVDEDKPADISPDAPKAEAKSAD 760
               D +K A +  +A K + +SAD
Sbjct: 516 TESADSEKKAPVKREADKPKTESAD 540



 Score = 27.9 bits (59), Expect = 8.6
 Identities = 26/85 (30%), Positives = 36/85 (42%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLA 685
           +A   +E  P  T+   SADS    P   K+    P  ES   A  E K P   +A    
Sbjct: 584 KAPAKREADPPKTE---SADSEKKAP--AKREADPPKTES---ADSEKKAPAKREADPPK 635

Query: 686 DNPVDEDKPADISPDAPKAEAKSAD 760
               D +K A +  +A K + +SAD
Sbjct: 636 TESADSEKKAPVKREADKPKTESAD 660


>Z50874-10|CAA90770.1|  302|Caenorhabditis elegans Hypothetical
           protein R10E4.11 protein.
          Length = 302

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 20/77 (25%), Positives = 31/77 (40%)
 Frame = +2

Query: 524 EEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDE 703
           E+  S  D    A   + +  M +++ +  +  S     PEI   +    PKL +   +E
Sbjct: 81  EDSDSVADDSDGATHGSRLEEMQERLKILGSKRSK----PEIPIKDLEVVPKLEEEAEEE 136

Query: 704 DKPADISPDAPKAEAKS 754
           D    I P  PK  A S
Sbjct: 137 DMDIQILPSPPKMYACS 153


>AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 192 protein.
          Length = 2957

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 1/85 (1%)
 Frame = +2

Query: 515 ISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKT-PEAADAPKLADN 691
           + + E+    + E      ++ P  V+        +++   IP + T  E A+ P  A+ 
Sbjct: 734 LDQVEQNDYENIEKEEPQVSVDPEPVEVEAQQEPADTEEYPIPSVGTIEEPAEEP--AEE 791

Query: 692 PVDEDKPADISPDAPKAEAKSADDL 766
           PV+E +P D S    ++    ADD+
Sbjct: 792 PVEEPEPMDDSSPVDQSTPVKADDI 816


>L10986-3|AAA28018.1|  650|Caenorhabditis elegans Abnormal cell
           migration protein10, isoform b protein.
          Length = 650

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 25/95 (26%), Positives = 34/95 (35%), Gaps = 2/95 (2%)
 Frame = +2

Query: 497 TSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAP 676
           TS + EI  +E+P+ T      D    +          P  ESD+    E   P    + 
Sbjct: 530 TSAKLEIQYDEQPTGTIKRAPLDVLRRVSRASTSSPTIPQEESDSD--EEFPAPPPVASV 587

Query: 677 KLADNPVDEDKPAD--ISPDAPKAEAKSADDLRLQ 775
                PV   KP     S  AP    K +D  +LQ
Sbjct: 588 MRMPPPVTPPKPCTPLTSKKAPPPPPKRSDTTKLQ 622


>L10986-2|AAK84523.2|  667|Caenorhabditis elegans Abnormal cell
           migration protein10, isoform a protein.
          Length = 667

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 25/95 (26%), Positives = 34/95 (35%), Gaps = 2/95 (2%)
 Frame = +2

Query: 497 TSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAP 676
           TS + EI  +E+P+ T      D    +          P  ESD+    E   P    + 
Sbjct: 547 TSAKLEIQYDEQPTGTIKRAPLDVLRRVSRASTSSPTIPQEESDSD--EEFPAPPPVASV 604

Query: 677 KLADNPVDEDKPAD--ISPDAPKAEAKSADDLRLQ 775
                PV   KP     S  AP    K +D  +LQ
Sbjct: 605 MRMPPPVTPPKPCTPLTSKKAPPPPPKRSDTTKLQ 639


>L10986-1|AAR25648.1|  779|Caenorhabditis elegans Abnormal cell
           migration protein10, isoform c protein.
          Length = 779

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 25/95 (26%), Positives = 34/95 (35%), Gaps = 2/95 (2%)
 Frame = +2

Query: 497 TSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAP 676
           TS + EI  +E+P+ T      D    +          P  ESD+    E   P    + 
Sbjct: 659 TSAKLEIQYDEQPTGTIKRAPLDVLRRVSRASTSSPTIPQEESDSD--EEFPAPPPVASV 716

Query: 677 KLADNPVDEDKPAD--ISPDAPKAEAKSADDLRLQ 775
                PV   KP     S  AP    K +D  +LQ
Sbjct: 717 MRMPPPVTPPKPCTPLTSKKAPPPPPKRSDTTKLQ 751


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,215,212
Number of Sequences: 27780
Number of extensions: 259684
Number of successful extensions: 1304
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 1092
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1262
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1882685842
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -