SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation fact...   225   3e-59
U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation fact...   225   3e-59
U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation fact...   225   3e-59
U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation fact...   193   9e-50
Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical pr...   127   9e-30
Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical pr...   127   9e-30
Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical pr...   127   9e-30
U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation fact...   103   1e-22
D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation fact...    68   6e-12
D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation fact...    68   6e-12
AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongatio...    68   6e-12
U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation f...    62   5e-10
AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial...    62   5e-10
Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical pr...    43   3e-04
L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical pr...    41   8e-04
M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation fact...    40   0.002
Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical pr...    40   0.002
AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical ...    38   0.006
Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical p...    38   0.007
Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical pr...    32   0.48 
U70852-1|AAK29815.1| 2361|Caenorhabditis elegans Hypothetical pr...    31   0.64 
U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation fact...    31   1.1  
M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.        31   1.1  
AF125969-2|AAD14761.1|  613|Caenorhabditis elegans Caenorhabditi...    31   1.1  
AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical ...    31   1.1  
Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical pr...    30   1.5  
DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic tr...    30   2.0  
AL008869-2|CAC42315.1|  810|Caenorhabditis elegans Hypothetical ...    29   2.6  
AL008869-1|CAA15516.1|  808|Caenorhabditis elegans Hypothetical ...    29   2.6  
AB032749-1|BAA92158.1|  810|Caenorhabditis elegans EAT-20B protein.    29   2.6  
AB032748-1|BAA92157.1|  808|Caenorhabditis elegans EAT-20A protein.    29   2.6  
U64846-8|AAG24109.1|  331|Caenorhabditis elegans Serpentine rece...    29   4.5  
Z75710-2|CAB00025.2|  381|Caenorhabditis elegans Hypothetical pr...    28   7.9  
L40996-1|AAA86431.1|  593|Caenorhabditis elegans GTP-binding pro...    28   7.9  

>U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation factor
           protein 4, isoformc protein.
          Length = 267

 Score =  225 bits (549), Expect = 3e-59
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 42/128 (32%), Positives = 58/128 (45%), Gaps = 4/128 (3%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLS 434
           MGKGSFKYAWVLDKL   +  R       + +   +   Y+         H++     ++
Sbjct: 49  MGKGSFKYAWVLDKL---KAERERGITIDIALWKFETAKYYI-TIIDAPGHRDFIKNMIT 104

Query: 435 G*LR--CAHR--SCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 602
           G  +  CA    +C      +        REHALLA TLGVKQL   V+    T  P S 
Sbjct: 105 GTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQL---VSLRSPTRSPDSS 161

Query: 603 PRFEEIKK 626
            R + I++
Sbjct: 162 RRSDTIQR 169


>U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation factor
           protein 4, isoforma protein.
          Length = 463

 Score =  225 bits (549), Expect = 3e-59
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  128 bits (309), Expect = 4e-30
 Identities = 80/164 (48%), Positives = 97/164 (59%), Gaps = 4/164 (2%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLS 434
           MGKGSFKYAWVLDKL   +  R       + +   +   Y+         H++     ++
Sbjct: 49  MGKGSFKYAWVLDKL---KAERERGITIDIALWKFETAKYYI-TIIDAPGHRDFIKNMIT 104

Query: 435 G*LR--CAHR--SCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 602
           G  +  CA    +C      +        REHALLA TLGVKQLIV  NKMDSTEPP+SE
Sbjct: 105 GTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSE 164

Query: 603 PRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
            RF EI  EVS +IKKIGYNP AV FVPISG++GDNMLE S+ M
Sbjct: 165 ARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNM 208


>U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation factor
           protein 3 protein.
          Length = 463

 Score =  225 bits (549), Expect = 3e-59
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGT 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  128 bits (309), Expect = 4e-30
 Identities = 80/164 (48%), Positives = 97/164 (59%), Gaps = 4/164 (2%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLS 434
           MGKGSFKYAWVLDKL   +  R       + +   +   Y+         H++     ++
Sbjct: 49  MGKGSFKYAWVLDKL---KAERERGITIDIALWKFETAKYYI-TIIDAPGHRDFIKNMIT 104

Query: 435 G*LR--CAHR--SCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 602
           G  +  CA    +C      +        REHALLA TLGVKQLIV  NKMDSTEPP+SE
Sbjct: 105 GTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSE 164

Query: 603 PRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
            RF EI  EVS +IKKIGYNP AV FVPISG++GDNMLE S+ M
Sbjct: 165 ARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNM 208


>U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation factor
           protein 4, isoformd protein.
          Length = 429

 Score =  193 bits (471), Expect = 9e-50
 Identities = 93/117 (79%), Positives = 97/117 (82%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K         
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
              +     GITIDIALWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVA 117



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/61 (72%), Positives = 50/61 (81%)
 Frame = +3

Query: 552 LIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTK 731
           L+V  NKMDSTEPP+SE RF EI  EVS +IKKIGYNP AV FVPISG++GDNMLE S+ 
Sbjct: 114 LVVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSN 173

Query: 732 M 734
           M
Sbjct: 174 M 174


>Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical
           protein H19N07.1 protein.
          Length = 532

 Score =  127 bits (306), Expect = 9e-30
 Identities = 60/132 (45%), Positives = 85/132 (64%)
 Frame = +1

Query: 115 GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWT 294
           G  K HIN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E  ++   +     
Sbjct: 104 GTHKEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMD 163

Query: 295 N*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                   G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  G
Sbjct: 164 TNDEEREKGKTVEVGRAYFETEKRHFTILDAPGHKSFVPNMIVGANQADLAVLVISARRG 223

Query: 475 EFEAGISKNGQT 510
           EFE G  + GQT
Sbjct: 224 EFETGFDRGGQT 235



 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 1/66 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REH++L  T GVK L++ VNKMD     + E RF+EI+ +++ +++K+G+NP   + +VP
Sbjct: 236 REHSMLVKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRKLGFNPKTDITYVP 295

Query: 687 ISGWHG 704
            SG  G
Sbjct: 296 CSGLTG 301


>Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical
           protein K07A12.4b protein.
          Length = 592

 Score =  127 bits (306), Expect = 9e-30
 Identities = 63/130 (48%), Positives = 81/130 (62%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA    K            
Sbjct: 167 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 226

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
                 G+T+DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEF
Sbjct: 227 EEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEF 286

Query: 481 EAGISKNGQT 510
           E G    GQT
Sbjct: 287 ETGFENGGQT 296



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 31/71 (43%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYI-KKIGYNPAAVAFVP 686
           +EHALL  +LGV QLIV VNK+D+ +  +S+ RF+EIK  +S ++ ++ G++     FVP
Sbjct: 297 KEHALLLRSLGVTQLIVAVNKLDTVD--WSQDRFDEIKNNLSVFLTRQAGFSKP--KFVP 352

Query: 687 ISGWHGDNMLE 719
           +SG+ G+N+++
Sbjct: 353 VSGFTGENLIK 363


>Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical
           protein K07A12.4a protein.
          Length = 610

 Score =  127 bits (306), Expect = 9e-30
 Identities = 63/130 (48%), Positives = 81/130 (62%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA    K            
Sbjct: 185 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 244

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
                 G+T+DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEF
Sbjct: 245 EEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEF 304

Query: 481 EAGISKNGQT 510
           E G    GQT
Sbjct: 305 ETGFENGGQT 314



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 31/71 (43%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYI-KKIGYNPAAVAFVP 686
           +EHALL  +LGV QLIV VNK+D+ +  +S+ RF+EIK  +S ++ ++ G++     FVP
Sbjct: 315 KEHALLLRSLGVTQLIVAVNKLDTVD--WSQDRFDEIKNNLSVFLTRQAGFSKP--KFVP 370

Query: 687 ISGWHGDNMLE 719
           +SG+ G+N+++
Sbjct: 371 VSGFTGENLIK 381


>U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation factor
           protein 4, isoformb protein.
          Length = 77

 Score =  103 bits (248), Expect = 1e-22
 Identities = 48/51 (94%), Positives = 48/51 (94%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVK 264
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE  K
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK 51



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 16/19 (84%), Positives = 17/19 (89%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAER 311
           MGKGSFKYAWVLDKLK  +
Sbjct: 49  MGKGSFKYAWVLDKLKVTK 67


>D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 495

 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 43/122 (35%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +        
Sbjct: 45  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKAR-------- 96

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+    ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA 
Sbjct: 97  ----------GITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAAT 146

Query: 469 TG 474
            G
Sbjct: 147 DG 148


>D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 496

 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 43/122 (35%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +        
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKAR-------- 97

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+    ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA 
Sbjct: 98  ----------GITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAAT 147

Query: 469 TG 474
            G
Sbjct: 148 DG 149


>AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 1 protein.
          Length = 496

 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 43/122 (35%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +        
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKAR-------- 97

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+    ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA 
Sbjct: 98  ----------GITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAAT 147

Query: 469 TG 474
            G
Sbjct: 148 DG 149


>U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 2 protein.
          Length = 439

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 44/120 (36%), Positives = 61/120 (50%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K ++N+  IGH+D GK+T T  +          T  + +K   + +K      G     R
Sbjct: 43  KINVNVGTIGHIDHGKTTLTSAI----------TRVQAKKGFAKHIKFDEIDKGKEEKKR 92

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                GITI++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E
Sbjct: 93  -----GITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME 147



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFV 683
           +EH +LA  +GVK + + +NK D  E    E   + ++ E    +   G+N  A   +
Sbjct: 150 KEHLILAKQVGVKNMAIFINKADLVE----EDDLDLVEMEARELLSLHGFNGDATPVI 203


>AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial
           elongation factorTu homologue protein.
          Length = 439

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 44/120 (36%), Positives = 61/120 (50%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K ++N+  IGH+D GK+T T  +          T  + +K   + +K      G     R
Sbjct: 43  KINVNVGTIGHIDHGKTTLTSAI----------TRVQAKKGFAKHIKFDEIDKGKEEKKR 92

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                GITI++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E
Sbjct: 93  -----GITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME 147



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFV 683
           +EH +LA  +GVK + + +NK D  E    E   + ++ E    +   G+N  A   +
Sbjct: 150 KEHLILAKQVGVKNMAIFINKADLVE----EDDLDLVEMEARELLSLHGFNGDATPVI 203


>Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical
           protein F29C12.4 protein.
          Length = 750

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 35/113 (30%), Positives = 49/113 (43%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  ++Y  G ID       E   ++ V    + +       L   
Sbjct: 46  NIGISAHIDSGKTTVTERILYYAGRID----SMHEVRGKDDVGATMDFMD------LERQ 95

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A    +     + IID PGH DF   +       D AVL++  G G
Sbjct: 96  RGITIQSAATYVDWHGTNINIIDTPGHVDFTVEVERALRVLDGAVLVL-CGVG 147


>L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical
           protein ZK1236.1 protein.
          Length = 645

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 31/116 (26%), Positives = 47/116 (40%), Gaps = 3/116 (2%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGI---DKRTIEKFEKEAQEWVKDPSNMLGYWTN*RL 306
           N  ++ HVD GKST    L+  CG +    K+ ++K + E +                  
Sbjct: 44  NFGIVAHVDHGKSTLADRLLEMCGAVPPGQKQMLDKLQVERER----------------- 86

Query: 307 SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               GIT+           Y + +ID PGH DF   +    +  D  +L+VAA  G
Sbjct: 87  ----GITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQG 138


>M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation factor
           protein.
          Length = 852

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 13/134 (9%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQE---WVKD 267
           M +++   N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE    +K 
Sbjct: 13  MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKS 72

Query: 268 PSNMLGYWTN*R-LSVSVG----ITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 432
            +  L +    + L    G     T+++   K + + + + +ID+PGH DF   +     
Sbjct: 73  TAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALG 132

Query: 433 QADCAVLIVAAGTG 474
             D A+++V   +G
Sbjct: 133 VTDGALVVVDCVSG 146


>Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical
           protein F25H5.4 protein.
          Length = 852

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 13/134 (9%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQE---WVKD 267
           M +++   N+ VI HVD GKST T  L+ K G I   K    +F    K+ QE    +K 
Sbjct: 13  MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKS 72

Query: 268 PSNMLGYWTN*R-LSVSVG----ITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 432
            +  L +    + L    G     T+++   K + + + + +ID+PGH DF   +     
Sbjct: 73  TAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALR 132

Query: 433 QADCAVLIVAAGTG 474
             D A+++V   +G
Sbjct: 133 VTDGALVVVDCVSG 146


>AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical
           protein Y119D3B.14 protein.
          Length = 689

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 32/113 (28%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI VI HVD+GK+T T  L+Y  G I               V D  N +  + +  +   
Sbjct: 27  NIGVIAHVDAGKTTVTERLLYLAGAI----------HVAGHV-DKGNTVTDFLD--IERE 73

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GIT+  A    +   + + +ID PGH DF   +       D  V+++    G
Sbjct: 74  RGITVQSAAVNLDWKGHRINLIDTPGHVDFRVEVERCVRVLDGIVVVIDGSAG 126


>Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical
           protein F46B6.6a protein.
          Length = 702

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GIT  I  +  E +K   VT +D PGH  F      G   AD  VL+VAA  G
Sbjct: 188 GITQHIGAFSVELTKGRRVTFLDTPGHAAFASMRARGAKGADIVVLVVAADDG 240


>Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical
           protein C47B2.7b protein.
          Length = 500

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 27/114 (23%), Positives = 51/114 (44%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N+ ++GHVDSGK+T T  +       +  +   F+  A     D           R ++
Sbjct: 14  LNLGILGHVDSGKTTLTRRI------AELGSTSAFDAHATSTTTDGIR--------RNTL 59

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            +G +   +L     S   + +ID PGH   I+ ++  ++  D A++I+    G
Sbjct: 60  DLGFSTMTSL-----SGRRLALIDCPGHSGLIRAVLAASTVFDMAIVIIDVVAG 108


>U70852-1|AAK29815.1| 2361|Caenorhabditis elegans Hypothetical protein
            F45E4.4 protein.
          Length = 2361

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +1

Query: 136  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
            +I+  GH+D   S   GH  +K  GI     E FE E ++  + P+   GY T+
Sbjct: 1633 SIIPSGHIDQPISLPRGHTGFKPAGIVNED-ELFETERKQREESPTRESGYATS 1685


>U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation factor
           protein 1 protein.
          Length = 974

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/49 (32%), Positives = 22/49 (44%)
 Frame = +1

Query: 328 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           + I      +  Y + IID PGH +F   M      AD  V++V A  G
Sbjct: 189 VSIVAQDSRSKSYLLNIIDTPGHVNFSDEMTASYRLADGVVVMVDAHEG 237


>M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.
          Length = 849

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/49 (32%), Positives = 22/49 (44%)
 Frame = +1

Query: 328 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           + I      +  Y + IID PGH +F   M      AD  V++V A  G
Sbjct: 64  VSIVAQDSRSKSYLLNIIDTPGHVNFSDEMTASYRLADGVVVMVDAHEG 112


>AF125969-2|AAD14761.1|  613|Caenorhabditis elegans Caenorhabditis
           gtp-binding proteinprotein 1 protein.
          Length = 613

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 35/134 (26%), Positives = 57/134 (42%), Gaps = 11/134 (8%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKC---GGIDKRT---IEKFEKEAQEWVKD 267
           P   K+     + V+G+VD+GKST  G L +     G    RT     K E E+      
Sbjct: 132 PPTEKDFIEARVAVVGNVDAGKSTLLGVLTHSALDDGRGAARTKLFRHKHEFESGRTSSV 191

Query: 268 PSNMLGYWTN*RLSVSV---GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS-- 432
            +++LG+  +  +          +D      + +K  VT ID  GH  ++K  I G +  
Sbjct: 192 GNDILGFDVHGNIVNKPDPHNHNLDWVQIGSDCAK-LVTFIDLAGHEKYLKTTIFGMTGH 250

Query: 433 QADCAVLIVAAGTG 474
             D  +L++ A  G
Sbjct: 251 MPDYTMLMIGANMG 264


>AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical
           protein Y39G10AR.8 protein.
          Length = 469

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A L+VA
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAAFLLVA 159


>Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical
           protein C47B2.7a protein.
          Length = 459

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 26/108 (24%), Positives = 49/108 (45%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N+ ++GHVDSGK+T T  +       +  +   F+  A     D           R ++
Sbjct: 14  LNLGILGHVDSGKTTLTRRI------AELGSTSAFDAHATSTTTDGIR--------RNTL 59

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 456
            +G +   +L     S   + +ID PGH   I+ ++  ++  D A++I
Sbjct: 60  DLGFSTMTSL-----SGRRLALIDCPGHSGLIRAVLAASTVFDMAIVI 102


>DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic
           translation initiationfactor eIF5B protein.
          Length = 1074

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           IID PGH  F      G+S  D A+L+V
Sbjct: 553 IIDTPGHESFSNLRTRGSSLCDFAILVV 580


>AL008869-2|CAC42315.1|  810|Caenorhabditis elegans Hypothetical
           protein H30A04.1b protein.
          Length = 810

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +1

Query: 634 PHTSRRLATTQLLSLSCPFLD 696
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AL008869-1|CAA15516.1|  808|Caenorhabditis elegans Hypothetical
           protein H30A04.1a protein.
          Length = 808

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +1

Query: 634 PHTSRRLATTQLLSLSCPFLD 696
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AB032749-1|BAA92158.1|  810|Caenorhabditis elegans EAT-20B protein.
          Length = 810

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +1

Query: 634 PHTSRRLATTQLLSLSCPFLD 696
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>AB032748-1|BAA92157.1|  808|Caenorhabditis elegans EAT-20A protein.
          Length = 808

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +1

Query: 634 PHTSRRLATTQLLSLSCPFLD 696
           PH SR   T   L+ SCPFLD
Sbjct: 158 PHLSRNSFTANALNCSCPFLD 178


>U64846-8|AAG24109.1|  331|Caenorhabditis elegans Serpentine
           receptor, class t protein19 protein.
          Length = 331

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = -1

Query: 414 VLDEISVSRSINDGNIVLASFELPESNIDCDTDAHAQPLVCPIP 283
           VLD+I    ++   N+VL  FEL  +   C  + H +P   P P
Sbjct: 2   VLDKIIPDFNLTLTNMVLNGFELDPNYYGCPEEVHKRPPSVPRP 45


>Z75710-2|CAB00025.2|  381|Caenorhabditis elegans Hypothetical
           protein D1081.4 protein.
          Length = 381

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 2/34 (5%)
 Frame = +1

Query: 370 VTIIDAPGHRDFI--KNMITGTSQADCAVLIVAA 465
           V IID+ G RDFI  KN+  GT  AD  +++ AA
Sbjct: 73  VQIIDSSGSRDFIGMKNLYIGT--ADAFLVVFAA 104


>L40996-1|AAA86431.1|  593|Caenorhabditis elegans GTP-binding
           protein protein.
          Length = 593

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIY 198
           P   K+     + V+G+VD+GKST  G L +
Sbjct: 132 PPTEKDFIEARVAVVGNVDAGKSTLLGVLTH 162


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,168,509
Number of Sequences: 27780
Number of extensions: 357344
Number of successful extensions: 1213
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1087
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1196
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1724918872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -