SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20025
         (696 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81556-9|CAB04522.1|   87|Caenorhabditis elegans Hypothetical pr...    29   4.2  
Z71261-2|CAA95805.1|  813|Caenorhabditis elegans Hypothetical pr...    29   4.2  
Z82285-5|CAB05298.2| 1679|Caenorhabditis elegans Hypothetical pr...    28   7.3  
Z74476-6|CAA98967.1| 1139|Caenorhabditis elegans Hypothetical pr...    27   9.7  
Z74473-6|CAA98951.1| 1139|Caenorhabditis elegans Hypothetical pr...    27   9.7  
Z68296-1|CAA92589.2|  520|Caenorhabditis elegans Hypothetical pr...    27   9.7  
U39471-1|AAA80132.4|  461|Caenorhabditis elegans Intestinal acid...    27   9.7  
U20168-1|AAA66364.1| 1139|Caenorhabditis elegans Lin-25 protein ...    27   9.7  

>Z81556-9|CAB04522.1|   87|Caenorhabditis elegans Hypothetical
           protein F58G1.9 protein.
          Length = 87

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +2

Query: 491 MLILVVHTPPQLVLSVQLMSVSF*CCIALRSLRILY 598
           ML+ ++ T   L+ S   +SV F CCI LR++ +LY
Sbjct: 13  MLVAILSTLDSLLHSETALSV-FDCCINLRNIGLLY 47


>Z71261-2|CAA95805.1|  813|Caenorhabditis elegans Hypothetical
           protein F21C3.2 protein.
          Length = 813

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = -2

Query: 299 CPAWKLRGRTRRNPPYSLGQ-DLPHGVHRENCDGKNCAE 186
           CP W  RG+ R NP Y   Q  +  GV R N     CA+
Sbjct: 718 CPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYGPCAD 756


>Z82285-5|CAB05298.2| 1679|Caenorhabditis elegans Hypothetical protein
            T28F3.5 protein.
          Length = 1679

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = -1

Query: 573  AIQHQKLTLISCTDKTS*GGVCTTRINMHYINDVPHITASGCLGLALI 430
            +I+HQ  T+ SC   T   G      +M + ND   ++ S C+  ALI
Sbjct: 891  SIEHQDFTVKSCKIVTHKSGFSDCVASMKFENDT-DVSISNCIDQALI 937


>Z74476-6|CAA98967.1| 1139|Caenorhabditis elegans Hypothetical
           protein F56H9.5 protein.
          Length = 1139

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -3

Query: 184 WYNASFLTLISLCTPLVGR 128
           W NASFLTL++   P++G+
Sbjct: 371 WQNASFLTLLNELEPVLGK 389


>Z74473-6|CAA98951.1| 1139|Caenorhabditis elegans Hypothetical
           protein F56H9.5 protein.
          Length = 1139

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -3

Query: 184 WYNASFLTLISLCTPLVGR 128
           W NASFLTL++   P++G+
Sbjct: 371 WQNASFLTLLNELEPVLGK 389


>Z68296-1|CAA92589.2|  520|Caenorhabditis elegans Hypothetical
           protein C46C2.2 protein.
          Length = 520

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -3

Query: 271 LGGTLLIHWARTSPTASTAKIATEKTALRWYNAS-FLTLISLCT 143
           + GT+++ WA  S   S  +    +T   W NA   LTL++L T
Sbjct: 173 IAGTMIVGWAYFSELVSPHQRFKLRTFSNWANARIMLTLVALFT 216


>U39471-1|AAA80132.4|  461|Caenorhabditis elegans Intestinal acid
           phosphatase protein4 protein.
          Length = 461

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +1

Query: 184 ISAQFFPSQFSRWTPW 231
           I  Q++P+QF ++TPW
Sbjct: 236 IEKQYYPAQFKQFTPW 251


>U20168-1|AAA66364.1| 1139|Caenorhabditis elegans Lin-25 protein
           protein.
          Length = 1139

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -3

Query: 184 WYNASFLTLISLCTPLVGR 128
           W NASFLTL++   P++G+
Sbjct: 371 WQNASFLTLLNELEPVLGK 389


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,540,371
Number of Sequences: 27780
Number of extensions: 298347
Number of successful extensions: 861
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 808
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 861
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1602927856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -