SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20019
         (587 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z50857-5|CAJ43436.1|  719|Caenorhabditis elegans Hypothetical pr...    29   1.9  
Z50857-4|CAC42283.1|  694|Caenorhabditis elegans Hypothetical pr...    29   1.9  
Z50857-3|CAC42284.1|  753|Caenorhabditis elegans Hypothetical pr...    29   1.9  
Z50857-1|CAC42285.1|  267|Caenorhabditis elegans Hypothetical pr...    29   1.9  
AF136240-1|AAD34464.1|  267|Caenorhabditis elegans DAF-12 B prot...    29   1.9  
AF136239-1|AAD34463.1|  694|Caenorhabditis elegans DAF-12 A2 pro...    29   1.9  
AF136238-1|AAD34462.1|  753|Caenorhabditis elegans DAF-12 A1 pro...    29   1.9  
U80454-8|ABC71798.1|  623|Caenorhabditis elegans Hypothetical pr...    29   3.2  
U80454-7|ABC48245.1|  650|Caenorhabditis elegans Hypothetical pr...    29   3.2  
U23524-6|AAC46820.1|  383|Caenorhabditis elegans Hypothetical pr...    29   3.2  
Z81515-10|CAH60782.1|  413|Caenorhabditis elegans Hypothetical p...    28   5.7  
Z81515-7|CAB04195.1|  510|Caenorhabditis elegans Hypothetical pr...    28   5.7  
U40030-2|AAR12978.2|  292|Caenorhabditis elegans Hypothetical pr...    28   5.7  

>Z50857-5|CAJ43436.1|  719|Caenorhabditis elegans Hypothetical
           protein F11A1.3d protein.
          Length = 719

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNS 335
           KF+LLK G+ + L VR +  +DA  NS
Sbjct: 549 KFSLLKGGMIEMLTVRGVTRYDASTNS 575


>Z50857-4|CAC42283.1|  694|Caenorhabditis elegans Hypothetical
           protein F11A1.3b protein.
          Length = 694

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNS 335
           KF+LLK G+ + L VR +  +DA  NS
Sbjct: 524 KFSLLKGGMIEMLTVRGVTRYDASTNS 550


>Z50857-3|CAC42284.1|  753|Caenorhabditis elegans Hypothetical
           protein F11A1.3a protein.
          Length = 753

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNS 335
           KF+LLK G+ + L VR +  +DA  NS
Sbjct: 583 KFSLLKGGMIEMLTVRGVTRYDASTNS 609


>Z50857-1|CAC42285.1|  267|Caenorhabditis elegans Hypothetical
           protein F11A1.3c protein.
          Length = 267

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNS 335
           KF+LLK G+ + L VR +  +DA  NS
Sbjct: 97  KFSLLKGGMIEMLTVRGVTRYDASTNS 123


>AF136240-1|AAD34464.1|  267|Caenorhabditis elegans DAF-12 B
           protein.
          Length = 267

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNS 335
           KF+LLK G+ + L VR +  +DA  NS
Sbjct: 97  KFSLLKGGMIEMLTVRGVTRYDASTNS 123


>AF136239-1|AAD34463.1|  694|Caenorhabditis elegans DAF-12 A2
           protein.
          Length = 694

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNS 335
           KF+LLK G+ + L VR +  +DA  NS
Sbjct: 524 KFSLLKGGMIEMLTVRGVTRYDASTNS 550


>AF136238-1|AAD34462.1|  753|Caenorhabditis elegans DAF-12 A1
           protein.
          Length = 753

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNS 335
           KF+LLK G+ + L VR +  +DA  NS
Sbjct: 583 KFSLLKGGMIEMLTVRGVTRYDASTNS 609


>U80454-8|ABC71798.1|  623|Caenorhabditis elegans Hypothetical
           protein T16A1.1b protein.
          Length = 623

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
 Frame = +2

Query: 155 QSEKEFSQRFAHV-IRGVIDF--AGLIPGFQLLTQDEIHAAQKWSVRC 289
           + EK+FS    H  I  +I+        G  L  Q E H  +KWS++C
Sbjct: 178 EDEKDFSDAVDHYNIPWIIEIIKTNEFLGIYLNCQKEYHEGRKWSIKC 225


>U80454-7|ABC48245.1|  650|Caenorhabditis elegans Hypothetical
           protein T16A1.1a protein.
          Length = 650

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
 Frame = +2

Query: 155 QSEKEFSQRFAHV-IRGVIDF--AGLIPGFQLLTQDEIHAAQKWSVRC 289
           + EK+FS    H  I  +I+        G  L  Q E H  +KWS++C
Sbjct: 178 EDEKDFSDAVDHYNIPWIIEIIKTNEFLGIYLNCQKEYHEGRKWSIKC 225


>U23524-6|AAC46820.1|  383|Caenorhabditis elegans Hypothetical
           protein C29F5.1 protein.
          Length = 383

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = -3

Query: 195 ITWAKRCENSFSDCSSGAGFSGQARVGCE*VGQSRALARMEATRSRVNSHVS 40
           IT A   +  F+ C+  AG  G  R+ CE VG++  L RMEA+      HV+
Sbjct: 118 ITDAINLQKIFAFCNE-AG-EGLFRIDCERVGKTVLLTRMEASDLMEIGHVT 167


>Z81515-10|CAH60782.1|  413|Caenorhabditis elegans Hypothetical
           protein F26H11.2g protein.
          Length = 413

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +2

Query: 104 TYSQPTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGFQLLTQD 253
           TY+ P+  CP      L     +  + A     + DFA ++P F+   QD
Sbjct: 12  TYTAPSQYCPSTVLSNLTLSCPYQDQEADASLEISDFAEVLPKFESAEQD 61


>Z81515-7|CAB04195.1|  510|Caenorhabditis elegans Hypothetical
           protein F26H11.2f protein.
          Length = 510

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +2

Query: 104 TYSQPTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGFQLLTQD 253
           TY+ P+  CP      L     +  + A     + DFA ++P F+   QD
Sbjct: 12  TYTAPSQYCPSTVLSNLTLSCPYQDQEADASLEISDFAEVLPKFESAEQD 61


>U40030-2|AAR12978.2|  292|Caenorhabditis elegans Hypothetical
           protein T13C2.7 protein.
          Length = 292

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 16/36 (44%), Positives = 19/36 (52%)
 Frame = -3

Query: 552 LSRECILSTSSMFRSRPIRSDEDYSQKSPISASVKF 445
           LSR    S SSM  S P+ SD   S K+  S +V F
Sbjct: 123 LSRSSRRSKSSMAESNPLNSDSTRSYKNENSLNVPF 158


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,071,054
Number of Sequences: 27780
Number of extensions: 263559
Number of successful extensions: 834
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 803
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 834
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1237082886
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -